Overview

  • Product name

    Anti-NRK antibody
  • Description

    Rabbit polyclonal to NRK
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human NRK aa 849-968.
    Sequence:

    GRRSQSSPPYSTIDQKLLVDIHVPDGFKVGKISPPVYLTNEWVGYNALSE IFRNDWLTPAPVIQPPEEDGDYVELYDASADTDGDDDDESNDTFEDTYDH ANGNDDLDNQVDQANDVCKD


    Database link: Q7Z2Y5

  • Positive control

    • IHC: Human placenta tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224394 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May phosphorylate cofilin-1 and induce actin polymerization through this process, during the late stages of embryogenesis. Involved in the TNF-alpha-induced signaling pathway.
  • Sequence similarities

    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
    Contains 1 CNH domain.
    Contains 1 protein kinase domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • C9orf95 antibody
    • Nicotinamide riboside kinase 1 antibody
    • Nicotinic acid riboside kinase 1 antibody
    • Nik-related protein kinase antibody
    • NRK 1 antibody
    • NRK antibody
    • NRK_HUMAN antibody
    • Ribosylnicotinamide kinase 1 antibody
    • Ribosylnicotinic acid kinase 1 antibody
    see all

Images

  • Paraffin-embedded human placenta tissue stained for NRK using ab224394 at 1/200 dilution in immunohistochemical analysis.

References

ab224394 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224394.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up