Overview

  • Product name

    Anti-NRP antibody
  • Description

    Rabbit polyclonal to NRP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human NRP aa 141-190 (internal sequence).
    Sequence:

    EISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDE


    Database link: P55209

  • Positive control

    • Rat thymus lysate.
  • General notes

    Previously labelled as RGD1560617.

Properties

Applications

Our Abpromise guarantee covers the use of ab150745 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 45 kDa.

Target

Images

  • Anti-NRP antibody (ab150745) at 1 µg/ml + Rat thymus lysate at 10 µg

    Predicted band size: 45 kDa

References

ab150745 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab150745.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up