Overview

  • Product name

  • Description

    Rabbit polyclonal to NRP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human NRP2 aa 150-420.
    Sequence:

    SKNFTSPNGTIESPGFPEKYPHNLDCTFTILAKPKMEIILQFLIFDLEHD PLQVGEGDCKYDWLDIWDGIPHVGPLIGKYCGTKTPSELRSSTGILSLTF HTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTY SDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAIS RETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLH APLLTRFVRIRPQTWHSGIAL


    Database link: O60462

  • Positive control

    • Mouse heart and brain extracts.

Properties

Applications

Our Abpromise guarantee covers the use of ab185710 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 105 kDa.Can be blocked with Recombinant Human NRP2 protein (ab160214).
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

Target

  • Function

    High affinity receptor for semaphorins 3C, 3F, VEGF-165 and VEGF-145 isoforms of VEGF, and the PLGF-2 isoform of PGF.
  • Sequence similarities

    Belongs to the neuropilin family.
    Contains 2 CUB domains.
    Contains 2 F5/8 type C domains.
    Contains 1 MAM domain.
  • Domain

    The tandem CUB domains mediate binding to semaphorin, while the tandem F5/8 domains are responsible for heparin and VEGF binding.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • MGC126574 antibody
    • Neuropilin 2 antibody
    • Neuropilin-2 antibody
    • Neuropilin2 antibody
    • NP 2 antibody
    • NP2 antibody
    • NPN 2 antibody
    • NPN2 antibody
    • NRP 2 antibody
    • Nrp2 antibody
    • NRP2_HUMAN antibody
    • PRO2714 antibody
    • Receptor for VEGF165 and semaphorins class3 antibody
    • Vascular endothelial cell growth factor 165 receptor 2 antibody
    • Vascular endothelial growth factor 165 receptor 2 antibody
    • VEGF1265R2 antibody
    • VEGF165R2 antibody
    see all

Images

  • All lanes : Anti-NRP2 antibody (ab185710) at 1/500 dilution

    Lane 1 : Mouse heart extract
    Lane 2 : Mouse brain extract

    Predicted band size: 105 kDa

References

This product has been referenced in:

  • Dong X  et al. Elevated expression of neuropilin-2 associated with unfavorable prognosis in hepatocellular carcinoma. Onco Targets Ther 10:3827-3833 (2017). Read more (PubMed: 28814881) »
  • Huang R  et al. Metastatic pathway and the microvascular and physicochemical microenvironments of human melanoma xenografts. J Transl Med 15:203 (2017). IHC ; Mouse . Read more (PubMed: 29017512) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185710.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up