Overview

  • Product name

  • Description

    Rabbit polyclonal to NRP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human NRP2 aa 60-209.
    Sequence:

    YAPEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIA PPTIISSGSMLYIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGT IESPGFPEKYPHNLDCTFTILAKPKMEIILQFLIFDLEHDPLQVGEGDCK


    Database link: O60462

  • Positive control

    • IHC-P: Human colon cancer and skeletal muscle tissues. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab234821 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    High affinity receptor for semaphorins 3C, 3F, VEGF-165 and VEGF-145 isoforms of VEGF, and the PLGF-2 isoform of PGF.
  • Sequence similarities

    Belongs to the neuropilin family.
    Contains 2 CUB domains.
    Contains 2 F5/8 type C domains.
    Contains 1 MAM domain.
  • Domain

    The tandem CUB domains mediate binding to semaphorin, while the tandem F5/8 domains are responsible for heparin and VEGF binding.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • MGC126574 antibody
    • Neuropilin 2 antibody
    • Neuropilin-2 antibody
    • Neuropilin2 antibody
    • NP 2 antibody
    • NP2 antibody
    • NPN 2 antibody
    • NPN2 antibody
    • NRP 2 antibody
    • Nrp2 antibody
    • NRP2_HUMAN antibody
    • PRO2714 antibody
    • Receptor for VEGF165 and semaphorins class3 antibody
    • Vascular endothelial cell growth factor 165 receptor 2 antibody
    • Vascular endothelial growth factor 165 receptor 2 antibody
    • VEGF1265R2 antibody
    • VEGF165R2 antibody
    see all

Images

  • Paraffin-embedded human colon cancer tissue stained for NRP2 using ab234821 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for NRP2 (green) using ab234821 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® congugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human skeletal muscle tissue tissue stained for NRP2 using ab234821 at 1/100 dilution in immunohistochemical analysis.

References

ab234821 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234821.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up