Overview

  • Product name

    Anti-NRSN1/VMP antibody
  • Description

    Rabbit polyclonal to NRSN1/VMP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human NRSN1/VMP aa 1-65.
    Sequence:

    MSSCSNVCGSRQAQAAAEGGYQRYGVRSYLHQFYEDCTASIWEYEDDFQI QRSPNRWSSVFWKVG


    Database link: Q8IZ57

  • Positive control

    • WB: Mouse stomach, thymus and gonad lysate; HeLa and HEK-293T whole cell lysates. ICC/IF: HeLa cells.
  • General notes

     This product was previously labelled as NRSN1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab237502 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 21 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Function

    May play an important role in neural organelle transport, and in transduction of nerve signals or in nerve growth. May play a role in neurite extension.
  • Tissue specificity

    Expressed in brain. Not detectable in other tissues tested.
  • Sequence similarities

    Belongs to the VMP family.
  • Cellular localization

    Membrane. Localizes mainly to neurites.
  • Information by UniProt
  • Database links

  • Alternative names

    • Neurensin-1 antibody
    • Neuro-p24 antibody
    • NRSN1 antibody
    • NRSN1_HUMAN antibody
    • p24 antibody
    • Vesicular membrane protein of 24 kDa antibody
    • Vesicular membrane protein p24 antibody
    • VMP antibody
    see all

Images

  • HeLa (Human epithelial cell line from cervix adenocarcinoma) cells stained for NRSN1/VMP (green) using ab237502 at 1/100 dilution in ICC/IF, followed by an Alexa Fluor®488 conjugated Goat Anti-Rabbit IgG (H+L).

  • All lanes : Anti-NRSN1/VMP antibody (ab237502) at 1/1000 dilution

    Lane 1 : Mouse stomach lysate
    Lane 2 : Mouse thymus lysate
    Lane 3 : Mouse gonad lysate
    Lane 4 : HeLa (Human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 5 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 21 kDa

References

ab237502 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237502.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up