Overview

  • Product name

  • Description

    Rabbit polyclonal to NRSN2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human NRSN2 aa 1-65.
    Sequence:

    MMPSCNRSCSCSRGPSVEDGKWYGVRSYLHLFYEDCAGTALSDDPEGPPV LCPRRPWPSLCWKIS


    Database link: Q9GZP1

  • Positive control

    • WB: Mouse liver tissue lysate. ICC/IF: A549 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab237739 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000.
ICC/IF 1/50 - 1/200.

Target

Images

  • Anti-NRSN2 antibody (ab237739) at 1/1000 dilution + Mouse liver tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution
  • A549 (Human lung carcinoma cell line) cells stained for NRSN2 (green) using ab237739 at 1/100 dilution in ICC/IF, followed by an Alexa-Fluor®488-conjugated goat anti-rabbit IgG (H+L).

References

ab237739 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237739.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up