Anti-NS21 antibody (ab235416)
Key features and details
- Rabbit polyclonal to NS21
- Suitable for: IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-NS21 antibody -
Description
Rabbit polyclonal to NS21 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow, Orangutan -
Immunogen
Recombinant fragment corresponding to Human NS21 aa 401-665.
Sequence:LAEGRLYLAQNTKVLQMLEGRLKEEDKDIITRENVLGALQKFSLRRPLQT AMIQDGLIFWLVDVLKDPDCLSDYTLEYSVALLMNLCLRSTGKNMCAKVA GLVLKVLSDLLGHENHEIQPYVNGALYSILSVPSIREEARAMGMEDILRC FIKEGNAEMIRQIEFIIKQLNSEELPDGVLESDDDEDEDDEEDHDIMEAD LDKDELIQPQLGELSGEKLLTTEYLGIMTNTGKTRRKGLANVQWSGDEPL QRPVTPGGHRNGYPV
Database link: Q7Z3E5 -
Positive control
- WB: Jurkat, CEM and A549 whole cell lysates. IHC-P: Human tonsil tissue.
-
General notes
Previously labelled as ARMC9.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: PBS, 50% Glycerol (glycerin, glycerine), 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab235416 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/20 - 1/200. | |
WB | 1/500 - 1/2000. Predicted molecular weight: 92 kDa. |
Target
-
Tissue specificity
Strongly expressed in most melanomas and melanocytes. Weakly expressed in the testis. -
Sequence similarities
Contains 1 LisH domain. - Information by UniProt
-
Database links
- Entrez Gene: 536462 Cow
- Entrez Gene: 80210 Human
- Entrez Gene: 78795 Mouse
- Entrez Gene: 100173624 Orangutan
- Entrez Gene: 301579 Rat
- GenBank: NM_025139 Human
- GenBank: NP_079415 Human
- SwissProt: Q2KI89 Cow
see all -
Alternative names
- ARM antibody
- armadillo repeat containing 9 antibody
- armadillo/beta-catenin-like repeats antibody
see all
Images
-
All lanes : Anti-NS21 antibody (ab235416) at 1/500 dilution
Lane 1 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
Lane 2 : CEM whole cell lysate
Lane 3 : A549 (human lung carcinoma cell line) whole cell lysate
Secondary
All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution
Predicted band size: 92 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NS21 antibody (ab235416)
Paraffin-embedded human tonsil tissue stained for NS21 using ab235416 at 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab235416 has not yet been referenced specifically in any publications.