Overview

  • Product name

  • Description

    Rabbit polyclonal to NSE
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Mouse NSE. Immunogen comprises aa1 - aa104 fused to aa224- aa434. N-terminal tag. Expressed in E. coli.
    Sequence:

    MSIEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELR DGDKQRYLGKGVLKAVDHINSRIAPALISSGISVVEQEKLDNLMLELDGT ENKSLELVKEAIDKAGYTEKMVIGMDVAASEFYRDGKYDLDFKSPADPSR YITGDQLGALYQDFVRNYPVVSIEDPFDQDDWAAWSKFTANVGIQIVGDD LTVTNPKRIERAVEEKACNCLLLKVNQIGSVTEAIQACKLAQENGWGVMV SHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGD EARFAGHNFRNPSVL


    Database link: P17183

  • Positive control

    • WB: Recombinant mouse NSE; mouse muscle, heart and brain tissue lysates. IHC-P: Mouse brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab231068 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Has neurotrophic and neuroprotective properties on a broad spectrum of central nervous system (CNS) neurons. Binds, in a calcium-dependent manner, to cultured neocortical neurons and promotes cell survival.
  • Tissue specificity

    The alpha/alpha homodimer is expressed in embryo and in most adult tissues. The alpha/beta heterodimer and the beta/beta homodimer are found in striated muscle, and the alpha/gamma heterodimer and the gamma/gamma homodimer in neurons.
  • Pathway

    Carbohydrate degradation; glycolysis; pyruvate from D-glyceraldehyde 3-phosphate: step 4/5.
  • Sequence similarities

    Belongs to the enolase family.
  • Developmental stage

    During ontogenesis, there is a transition from the alpha/alpha homodimer to the alpha/beta heterodimer in striated muscle cells, and to the alpha/gamma heterodimer in nerve cells.
  • Cellular localization

    Cytoplasm. Cell membrane. Can translocate to the plasma membrane in either the homodimeric (alpha/alpha) or heterodimeric (alpha/gamma) form.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2 phospho D glycerate hydrolyase antibody
    • 2-phospho-D-glycerate hydro-lyase antibody
    • Eno 2 antibody
    • ENO2 antibody
    • ENOG antibody
    • ENOG_HUMAN antibody
    • Enolase 2 (gamma, neuronal) antibody
    • Enolase 2 antibody
    • Enolase 2 gamma neuronal antibody
    • Enolase2 antibody
    • Epididymis secretory protein Li 279 antibody
    • Gamma enolase antibody
    • Gamma-enolase antibody
    • HEL S 279 antibody
    • Neural enolase antibody
    • Neuron specific enolase antibody
    • Neuron specific gamma enolase antibody
    • Neuron-specific enolase antibody
    • neuronal enriched enolase antibody
    • Neurone specific enolase antibody
    • NSE antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse brain tissue stained for NSE with ab231068 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • All lanes : Anti-NSE antibody (ab231068) at 1 µg/ml

    Lane 1 : Mouse muscle tissue lysate
    Lane 2 : Mouse heart tissue lysate
    Lane 3 : Mouse brain tissue lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution
  • Anti-NSE antibody (ab231068) at 2 µg/ml + Recombinant mouse NSE protein

References

ab231068 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231068.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up