Overview

  • Product name

  • Description

    Rabbit polyclonal to nSMase-3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Rabbit, Horse, Chicken, Guinea pig, Cow, Dog, Human
  • Immunogen

    Synthetic peptide corresponding to Rat nSMase-3 aa 301-350 (internal sequence). (UniProtKB/TrEMBL ID: F1MAK9)
    Sequence:

    LHSPAQPSLQALHAYQESFMPTEEHVLVVRLLLKHLHAFANSLKPDQASP

  • Positive control

    • Rat testis lysate
  • General notes

    Previously labelled as SMPD4.

Properties

Applications

Our Abpromise guarantee covers the use of ab133935 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 93 kDa.

Target

  • Function

    Catalyzes the hydrolysis of membrane sphingomyelin to form phosphorylcholine and ceramide.
  • Tissue specificity

    Widely expressed, with highest levels in heart and skeletal muscle.
  • Cellular localization

    Endoplasmic reticulum membrane. Golgi apparatus membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • EC 3.1.4.12 antibody
    • EC=3.1.4.123 antibody
    • FLJ20297 antibody
    • FLJ20756 antibody
    • KIAA1418 antibody
    • NET 13 antibody
    • NET13 antibody
    • Neutral sphingomyelinase 3 antibody
    • Neutral sphingomyelinase III antibody
    • NSMA3_HUMAN antibody
    • nSMase 3 antibody
    • nSMase-3 antibody
    • nSMase3 antibody
    • OTTHUMP00000162391 antibody
    • OTTHUMP00000190862 antibody
    • SKNY protein antibody
    • smpd4 antibody
    • Sphingomyelin phosphodiesterase 4 antibody
    • Sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase 3) antibody
    see all

Images

  • Anti-nSMase-3 antibody (ab133935) at 1 µg/ml + Rat testis lysate

    Predicted band size: 93 kDa

References

ab133935 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab133935.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up