Overview

  • Product name

  • Description

    Rabbit polyclonal to NSMase2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human NSMase2 aa 367-555. (BC112238).
    Sequence:

    DKRAATKLKEQLHGYFEYILYDVGVYGCQGCCSFKCLNSGLLFASRYPIM DVAYHCYPNKCNDDALASKGALFLKVQVGSTPQDQRIVGYIACTHLHAPQ EDSAIRCGQLDLLQDWLADFRKSTSSSSAANPEELVAFDVVCGDFNFDNC SSDDKLEQQHSLFTHYRDPCRLGPGEEKPWAIGTLLDTN


    Database link: Q9NY59

  • Positive control

    • Human fetal brain lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab199399 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 71 kDa.

Target

  • Function

    Catalyzes the hydrolysis of sphingomyelin to form ceramide and phosphocholine. Ceramide mediates numerous cellular functions, such as apoptosis and growth arrest, and is capable of regulating these 2 cellular events independently. Also hydrolyzes sphingosylphosphocholine. Regulates the cell cycle by acting as a growth suppressor in confluent cells. Probably acts as a regulator of postnatal development and participates in bone and dentin mineralization.
  • Tissue specificity

    Predominantly expressed in brain.
  • Sequence similarities

    Belongs to the neutral sphingomyelinase family.
  • Developmental stage

    Up-regulated during G0/G1 phases.
  • Cellular localization

    Golgi apparatus membrane. Cell membrane. May localize to detergent-resistant subdomains of Golgi membranes of hypothalamic neurosecretory neurons. According to PubMed:15051724, it localizes to plasma membrane in confluent contact-inhibited cells.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cca1 antibody
    • Confluent 3Y1 cell-associated protein 1 antibody
    • Neutral sphingomyelinase 2 antibody
    • Neutral sphingomyelinase II antibody
    • NSMA2_HUMAN antibody
    • nSMase-2 antibody
    • nSMase2 antibody
    • SMPD3 antibody
    • Sphingomyelin phosphodiesterase 3 antibody
    • sphingomyelin phosphodiesterase 3, neutral membrane (neutral sphingomyelinase II) antibody
    see all

Images

  • Anti-NSMase2 antibody (ab199399) at 1/500 dilution + Human fetal brain lysate

    Predicted band size: 71 kDa

References

ab199399 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab199399.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up