Overview

  • Product name

    Anti-NSP 5 alpha 3 alpha antibody
    See all NSP 5 alpha 3 alpha primary antibodies
  • Description

    Rabbit polyclonal to NSP 5 alpha 3 alpha
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse NSP 5 alpha 3 alpha aa 961-1063. (Expressed in E.coli).
    Sequence:

    GGSKRNALLKWCQKKTEGYANIDITNFSSSWSDGLALCALLHTYLPAHIP YQELNSQEKKRNLLLAFEAAQSVGINPSLELSEMLYTDRPDWQSVMQYVA QIYK


    Database link: Q5SXY1

  • Positive control

    • IHC-P: Mouse uterus tissue. WB: HeLa lysate; Recombinant mouse NSP 5 alpha 3 alpha.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232996 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 118 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Tissue specificity

    Highly expressed in testis. Barely detectable in other tissues. Also highly expressed in some cancer cell lines.
  • Involvement in disease

    Note=A chromosomal aberration involving CYTSB may be a cause of juvenile myelomonocytic leukemia. Translocation t(5;17)(q33;p11.2) with PDGFRB.
  • Sequence similarities

    Belongs to the cytospin-A family.
    Contains 1 CH (calponin-homology) domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cytokinesis and spindle organization B antibody
    • Cytospin B antibody
    • Cytospin-B antibody
    • CYTSB antibody
    • CYTSB_HUMAN antibody
    • FLJ36955 antibody
    • HCMOGT 1 antibody
    • HCMOGT antibody
    • HCMOGT-1 antibody
    • NSP antibody
    • NSP5 antibody
    • Nuclear structure protein 5 antibody
    • Specc1 antibody
    • Spectrin domain with coiled coils 1 antibody
    • Sperm antigen HCMOGT 1 antibody
    • Sperm antigen HCMOGT-1 antibody
    • Sperm antigen with calponin homology and coiled coil domains 1 antibody
    • Sperm antigen with calponin homology and coiled-coil domains 1 antibody
    • sperm antigen with calponin-like and coiled coil domains 1 antibody
    • Structure protein NSP5a3a antibody
    • Structure protein NSP5a3b antibody
    • Structure protein NSP5b3a antibody
    • Structure protein NSP5b3b antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse uterus tissue stained for NSP 5 alpha 3 alpha using ab232996 at 10 µg/ml in immunohistochemistry analysis. DAB staining.

  • Anti-NSP 5 alpha 3 alpha antibody (ab232996) at 2 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Predicted band size: 118 kDa

  • Anti-NSP 5 alpha 3 alpha antibody (ab232996) at 2 µg/ml + Recombinant mouse NSP 5 alpha 3 alpha protein

    Predicted band size: 118 kDa

References

ab232996 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232996.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up