Overview

  • Product name

  • Description

    Rabbit polyclonal to NSUN2/SAKI
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to Human NSUN2/SAKI aa 614-663.
    Sequence:

    FINSRIITVSMEDVKILLTQENPFFRKLSSETYSQAKDLAKGSIVLKYEP

  • Positive control

    • HeLa cell lysate.
  • General notes

     This product was previously labelled as NSUN2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab75493 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 86 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay: 1/62500.

Target

  • Function

    RNA methyltransferase that methylates tRNAs, and possibly RNA polymerase III transcripts. Methylates cytosine to 5-methylcytosine (m5C) at position 34 of intron-containing tRNA(Leu)(CAA) precursors. Not able to modify tRNAs at positions 48 or 49. May act downstream of Myc to regulate epidermal cell growth and proliferation.
  • Sequence similarities

    Belongs to the methyltransferase superfamily. RsmB/NOP family. TRM4 subfamily.
  • Post-translational
    modifications

    Phosphorylated at Ser-139 by Aurora-B/STK12 during mitosis, leading to abolish methyltransferase activity and the interaction with NPM1.
  • Cellular localization

    Nucleus > nucleolus. Cytoplasm. Concentrated in the nucleolus during interphase and distributed in the perichromosome and cytoplasm during mitosis.
  • Information by UniProt
  • Database links

  • Alternative names

    • 5 methycytoisine methyltransferase antibody
    • D13Wsu123e antibody
    • FLJ20303 antibody
    • hTrm4 antibody
    • MISU antibody
    • Myc induced SUN domain containing protein antibody
    • NOL1/NOP2/Sun domain family 2 antibody
    • NOL1/NOP2/Sun domain family 2 protein antibody
    • NOL1/NOP2/Sun domain family member 2 antibody
    • NSUN 2 antibody
    • NSUN2 antibody
    • NSUN2_HUMAN antibody
    • SAKI antibody
    • Substrate of AIM1/Aurora kinase B antibody
    • TRM4 antibody
    • tRNA (cytosine 5 ) methyltransferase antibody
    • tRNA (cytosine 5 ) methyltransferase NSUN2 antibody
    • tRNA (cytosine(34)-C(5))-methyltransferase antibody
    • tRNA (cytosine-5-)-methyltransferase antibody
    • tRNA methyltransferase 4 homolo antibody
    • tRNA methyltransferase 4 homolog antibody
    see all

Images

  • Anti-NSUN2/SAKI antibody (ab75493) at 1 µg/ml (in 5% skim milk / PBS buffer) + HeLa cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 86 kDa
    Observed band size: 86 kDa



    Gel concentration:12%

References

ab75493 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Pig Cell lysate - whole cell (ST cells (Swine Testicle))
Gel Running Conditions
Reduced Denaturing (10% polyacrylamide gel)
Loading amount
40 µg
Specification
ST cells (Swine Testicle)
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 20°C

Abcam user community

Verified customer

Submitted Jun 25 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up