Overview

  • Product name

  • Description

    Rabbit polyclonal to NT2NL
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Cow, Human
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human NT2NL aa 1-236. Expressed in E.coli. N-terminal tags.
    Sequence:

    MCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKAT CRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTG KECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNECDIP GHCQHGGTCLNLPGSYQCQCLQGFTGQYCDSLYVPCAPSPCVNGGTCRQT GDFTFECNCLPETVRRGTELWERDREVWNGKEHDEN


    Database link: Q7Z3S9

  • Positive control

    • IHC-P: Human stomach tissue. WB: Recombinant human NT2NL protein; Human lung lysate; HeLa and A549 lysate; Bovine testis lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233287 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml.

Target

  • Function

    May function in the Notch signaling pathway and regulate neutrophil differentiation.
  • Tissue specificity

    Widely expressed with higher levels in leukocytes and lymph nodes.
  • Sequence similarities

    Belongs to the NOTCH family.
    Contains 6 EGF-like domains.
  • Post-translational
    modifications

    Cleaved by ELANE.
  • Cellular localization

    Secreted. Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • N2N antibody
    • Notch 2 N terminal like antibody
    • Notch homolog 2 (Drosophila) N-terminal like antibody
    • Notch homolog 2 N-terminal-like protein antibody
    • NOTCH2NL antibody
    • NT2NL_HUMAN antibody
    • OTTHUMP00000015593 antibody
    see all

Images

  • All lanes : Anti-NT2NL antibody (ab233287) at 1 µg/ml

    Lane 1 : Human lung tissue lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 3 : A549 (human lung carcinoma cell line) cell lysate
    Lane 4 : Bovine testis tissue lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
  • Formalin-fixed, paraffin-embedded human stomach tissue stained for NT2NL using ab233287 at 10 µg/mL in immunohistochemical analysis. DAB staining.

  • Anti-NT2NL antibody (ab233287) at 2 µg/ml + Recombinant human NT2NL protein

References

ab233287 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233287.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up