Overview

  • Product name

  • Description

    Rabbit polyclonal to NT5C1A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide within Human NT5C1A aa 151-200 (internal sequence). The exact sequence is proprietary. NP_115915.1
    Sequence:

    FCMTGGNSPICYLKAYHTNLYLSADAEKVR EAIDEGIAAATIFSPSRDVV


    Database link: Q9BXI3

  • Positive control

    • Human skeletal muscle tissue; A549 cells; HepG2 and MCF7 cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab190214 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/100 - 1/500.
WB 1/500 - 1/1000. Predicted molecular weight: 41 kDa.
IHC-P Use a concentration of 10 µg/ml.

Target

  • Function

    Dephosphorylates the 5' and 2'(3')-phosphates of deoxyribonucleotides and has a broad substrate specificity. Helps to regulate adenosine levels in heart during ischemia and hypoxia.
  • Tissue specificity

    Highly expressed in skeletal muscle. Detected at intermediate levels in heart, brain, kidney and pancreas.
  • Sequence similarities

    Belongs to the 5'-nucleotidase type 3 family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 5' nucleotidase cytosolic IA antibody
    • 5NT1A_HUMAN antibody
    • AMP specific 5' NT antibody
    • CN I antibody
    • CN IA antibody
    • cN-I antibody
    • cN-IA antibody
    • CN1 antibody
    • cN1A antibody
    • cNI antibody
    • cNIA antibody
    • Cytosolic 5' nucleotidase 1A antibody
    • Cytosolic 5' nucleotidase IA antibody
    • Cytosolic 5' nucleotidase type 1A antibody
    • Cytosolic 5''-nucleotidase 1A antibody
    • Cytosolic 5''-nucleotidase IA antibody
    • MGC119199 antibody
    • MGC119201 antibody
    • NT5C1A antibody
    • nucleotidase, 5-prime, cytosolic, IA antibody
    see all

Images

  • Immunohistochemical analysis of formalin fixed, paraffin embedded Human skeletal muscle tissue labeling NT5C1A using ab190214 at 10 µg/ml.

  • Immunofluorescent analysis of A549 cells labeling NT5C1A using ab190214 at 1/100 dilution. The image on the right is treated with the synthesized peptide.

  • All lanes : Anti-NT5C1A antibody (ab190214) at 1/500 dilution

    Lane 1 : MCF7 cell lysate
    Lane 2 : HepG2 cell lysate
    Lane 3 : MCF7 cell lysate treated with the synthesized peptide

    Predicted band size: 41 kDa

References

ab190214 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190214.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up