Overview

  • Product name

  • Description

    Rabbit polyclonal to NT5C/dNT-1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse NT5C/dNT-1 aa 12-200. (Expressed in E.coli).
    Sequence:

    DMDGVLADFESGLLQGFRRRFPEEPHVPLEQRRGFLANEQYGALRPDLAE KVASVYESPGFFLNLEPIPGALDALREMNDMKDTEVFICTTPLLKYDHCV GEKYRWVEQNLGPEFVERIILTRDKTVVMGDLLIDDKDNIQGLEETPSWE HILFTCCHNQHLALPPTRRRLLSWSDNWRGIIESKRASL


    Database link: Q9JM14

  • Positive control

    • IHC-P: Mouse heart and skeletal muscle tissues. WB: Mouse stomach lysate; Human placenta lysate; K562 and HEK-293T cell lysates; Recombinant mouse NT5C/dNT-1 protein.
  • General notes

    Previously labelled as NT5C.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231126 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231126 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 23 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Dephosphorylates the 5' and 2'(3')-phosphates of deoxyribonucleotides, with a preference for dUMP and dTMP, intermediate activity towards dGMP, and low activity towards dCMP and dAMP.
  • Tissue specificity

    Detected in skeletal muscle, heart and pancreas.
  • Sequence similarities

    Belongs to the 5'(3')-deoxyribonucleotidase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 3''-pyrimidine nucleotidase antibody
    • 5' nucleotidase, deoxy (pyrimidine) antibody
    • 5' nucleotidase, deoxy (pyrimidine), cytosolic type C antibody
    • 5''(3'')-deoxyribonucleotidase antibody
    • 5'(3')-deoxyribonucleotidase, cytosolic type antibody
    • 5', 3'-nucleotidase, cytosolic antibody
    • 5-prime,3-prime-nucleotidase, cytosolic antibody
    • cdN antibody
    • Cytosolic 5'' antibody
    • cytosolic 5',3'-pyrimidine nucleotidase antibody
    • cytosolic type antibody
    • cytosolic type C,5',3'-nucleotidase antibody
    • cytosolic,uridine 5'-monophosphate phosphohydrolase 2 antibody
    • Deoxy 5' nucleotidase 1 antibody
    • Deoxy-5''-nucleotidase 1 antibody
    • Deoxyribonucleotidase, cytosolic, 1 antibody
    • DNT antibody
    • dNT-1 antibody
    • dNT1 antibody
    • Nt5c antibody
    • NT5C_HUMAN antibody
    • P5N2 antibody
    • PN-I antibody
    • PN-II antibody
    • Pyrimidine 5-prime nucleotidase 2 antibody
    • UMPH2 antibody
    • uridine 5'-monophosphate phosphohydrolase 2 antibody
    • uridine 5-prime monophosphate hydrolase 2 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse heart tissue stained for NT5C/dNT-1 using ab231126 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse skeletal muscle tissue stained for NT5C/dNT-1 using ab231126 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-NT5C/dNT-1 antibody (ab231126) at 2 µg/ml + Recombinant mouse NT5C/dNT-1 protein

    Predicted band size: 23 kDa

  • Anti-NT5C/dNT-1 antibody (ab231126) at 2 µg/ml + mouse stomach lysate

    Predicted band size: 23 kDa

  • Anti-NT5C/dNT-1 antibody (ab231126) at 2 µg/ml + Human placenta lysate

    Predicted band size: 23 kDa

  • Anti-NT5C/dNT-1 antibody (ab231126) at 2 µg/ml + HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Predicted band size: 23 kDa

  • Anti-NT5C/dNT-1 antibody (ab231126) at 2 µg/ml + K562 (human chronic myelogenous leukemia cell line from bone marrow ) cell lysate

    Predicted band size: 23 kDa

References

ab231126 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231126.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up