Overview

  • Product name

  • Description

    Rabbit polyclonal to NTF2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Cow, Orangutan
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human NTF2 aa 1-127. Expressed in E.coli. N-terminal tags.
    Sequence:

    MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKA AIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFH QMFLLKNINDAWVCTNDMFRLALHNFG


    Database link: P61970

  • Positive control

    • WB: Recombinant human NTF2; human urine; U-2 OS, HeLa and K562 cell lysates. IHC-P: Human kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231185 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 14 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for NTF2 with ab231185 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-NTF2 antibody (ab231185) at 1 µg/ml + Human urine

    Predicted band size: 14 kDa

  • Anti-NTF2 antibody (ab231185) at 2 µg/ml + U-2 OS (human bone osteosarcoma epithelial cell line) cell lysate

    Predicted band size: 14 kDa

  • Anti-NTF2 antibody (ab231185) at 2 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Predicted band size: 14 kDa

  • Anti-NTF2 antibody (ab231185) at 2 µg/ml + K562 (human chronic myelogenous leukemia cell line from bone marrow) cell lysate

    Predicted band size: 14 kDa

  • Anti-NTF2 antibody (ab231185) at 2 µg/ml + Recombinant human NTF2 protein

    Predicted band size: 14 kDa

References

ab231185 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231185.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up