Overview

  • Product name

  • Description

    Rabbit polyclonal to NTH1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human NTH1 aa 31-312. Full length mature protein without the transit peptide.
    Sequence:

    GCREEPGPLRRREAAAEARKSHSPVKRPRKAQRLRVAYEGSDSEKGEGAE PLKVPVWEPQDWQQQLVNIRAMRNKKDAPVDHLGTEHCYDSSAPPKVRRY QVLLSLMLSSQTKDQVTAGAMQRLRARGLTVDSILQTDDATLGKLIYPVG FWRSKVKYIKQTSAILQQHYGGDIPASVAELVALPGVGPKMAHLAMAVAW GTVSGIAVDTHVHRIANRLRWTKKATKSPEETRAALEEWLPRELWHEING LLVGFGQQTCLPVHPRCHACLNQALCPAAQGL


    Database link: P78549

  • Positive control

    • WB: NIH/3T3 cell lysate. IHC-P: Human glioma tissue. ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236912 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Has both an apurinic and/or apyrimidinic endonuclease activity and a DNA N-glycosylase activity. Incises damaged DNA at cytosines, thymines and guanines. Acts on a damaged strand, 5' from the damaged site. Required for the repair of both oxidative DNA damage and spontaneous mutagenic lesions.
  • Tissue specificity

    Widely expressed with highest levels in heart and lowest levels in lung and liver.
  • Sequence similarities

    Belongs to the Nth/MutY family.
  • Developmental stage

    Expression levels are regulated during the cell cycle with increased levels during early and mid S-phase.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Bifunctional DNA N glycoslyase/DNA (apurinic or apyrimidinic site) lyase antibody
    • DNA glycoslyase/AP lyase antibody
    • Endonuclease III like protein 1 antibody
    • Endonuclease III-like protein 1 antibody
    • hNTH1 antibody
    • NTH 1 antibody
    • nth endonuclease III like 1 (E. coli) antibody
    • NTH endonuclease III Like 1 antibody
    • NTH1 antibody
    • NTHL 1 antibody
    • Nthl1 antibody
    • NTHL1_HUMAN antibody
    • OCTS 3 antibody
    • OCTS3 antibody
    see all

Images

  • Anti-NTH1 antibody (ab236912) at 1/500 dilution + NIH/3T3 (mouse embryo fibroblast cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution
  • Paraffin-embedded human glioma tissue stained for NTH1 using ab236912 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for NTH1 using ab236912 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488-conjugated goat anti-rabbit IgG (H+L).

References

ab236912 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236912.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up