Anti-NUBP1 antibody (ab243521)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-NUBP1 antibody -
Description
Rabbit polyclonal to NUBP1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human NUBP1 aa 230-320.
Sequence:MSGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDK GQSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS
Database link: P53384 -
Positive control
- IHC-P: Human liver, kidney, testis and colon tissues. WB: Control siRNA transfected U-2 OS cell lysate; RT4 and U-251 MG cell lysates; Human liver and tonsil lysates. ICC/IF: U-2 OS cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab243521 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.4 µg/ml. Predicted molecular weight: 35 kDa. | |
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
| IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Implicated in the regulation of centrosome duplication (By similarity). Component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. Required for maturation of extramitochondrial Fe/S proteins. May bind and transfer 2 labile 4Fe-4S clusters to target apoproteins. -
Sequence similarities
Belongs to the Mrp/NBP35 ATP-binding proteins family. NUBP1/NBP35 subfamily. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 4682 Human
- Omim: 600280 Human
- SwissProt: P53384 Human
- Unigene: 81469 Human
-
Alternative names
- MGC130052 antibody
- Cytosolic Fe S cluster assembly factor NUBP1 antibody
- Cytosolic Fe-S cluster assembly factor NUBP1 antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-NUBP1 antibody (ab243521)PFA fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells labeling NUBP1 using ab243521 at 4 µg/ml (green) in ICC/IF.
-
Western blot - Anti-NUBP1 antibody (ab243521)All lanes : Anti-NUBP1 antibody (ab243521) at 0.4 µg/ml
Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
Lane 2 : U-251 MG (human brain glioma cell line) cell lysate
Lane 3 : Human plasma
Lane 4 : Human liver lysate
Lane 5 : Human tonsil lysate
Predicted band size: 35 kDa -
Western blot - Anti-NUBP1 antibody (ab243521)All lanes : Anti-NUBP1 antibody (ab243521) at 0.4 µg/ml
Lane 1 : siRNA#1 transfected U-2 OS (human bone osteosarcoma epithelial cell line) cell lysate
Lane 2 : siRNA#2 transfected U-2 OS cell lysate
Lane 3 : Control siRNA transfected U-2 OS cell lysate
Predicted band size: 35 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NUBP1 antibody (ab243521)Paraffin-embedded human colon tissue stained for NUBP1 using ab243521 at 1/200 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NUBP1 antibody (ab243521)Paraffin-embedded human kidney tissue stained for NUBP1 using ab243521 at 1/200 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NUBP1 antibody (ab243521)Paraffin-embedded human testis tissue stained for NUBP1 using ab243521 at 1/200 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NUBP1 antibody (ab243521)Paraffin-embedded human liver tissue stained for NUBP1 using ab243521 at 1/200 dilution in immunohistochemical analysis.
Datasheets and documents
References
ab243521 has not yet been referenced specifically in any publications.
