Anti-NUBP1 antibody (ab243521)
Key features and details
- Rabbit polyclonal to NUBP1
- Suitable for: WB, ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-NUBP1 antibody -
Description
Rabbit polyclonal to NUBP1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human NUBP1 aa 230-320.
Sequence:MSGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDK GQSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS
Database link: P53384 -
Positive control
- IHC-P: Human liver, kidney, testis and colon tissues. WB: Control siRNA transfected U-2 OS cell lysate; RT4 and U-251 MG cell lysates; Human liver and tonsil lysates. ICC/IF: U-2 OS cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab243521 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 35 kDa. | |
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Implicated in the regulation of centrosome duplication (By similarity). Component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. Required for maturation of extramitochondrial Fe/S proteins. May bind and transfer 2 labile 4Fe-4S clusters to target apoproteins. -
Sequence similarities
Belongs to the Mrp/NBP35 ATP-binding proteins family. NUBP1/NBP35 subfamily. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 4682 Human
- Omim: 600280 Human
- SwissProt: P53384 Human
- Unigene: 81469 Human
-
Alternative names
- MGC130052 antibody
- Cytosolic Fe S cluster assembly factor NUBP1 antibody
- Cytosolic Fe-S cluster assembly factor NUBP1 antibody
see all
Images
-
PFA fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells labeling NUBP1 using ab243521 at 4 µg/ml (green) in ICC/IF.
-
All lanes : Anti-NUBP1 antibody (ab243521) at 0.4 µg/ml
Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
Lane 2 : U-251 MG (human brain glioma cell line) cell lysate
Lane 3 : Human plasma
Lane 4 : Human liver lysate
Lane 5 : Human tonsil lysate
Predicted band size: 35 kDa -
All lanes : Anti-NUBP1 antibody (ab243521) at 0.4 µg/ml
Lane 1 : siRNA#1 transfected U-2 OS (human bone osteosarcoma epithelial cell line) cell lysate
Lane 2 : siRNA#2 transfected U-2 OS cell lysate
Lane 3 : Control siRNA transfected U-2 OS cell lysate
Predicted band size: 35 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NUBP1 antibody (ab243521)
Paraffin-embedded human colon tissue stained for NUBP1 using ab243521 at 1/200 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NUBP1 antibody (ab243521)
Paraffin-embedded human kidney tissue stained for NUBP1 using ab243521 at 1/200 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NUBP1 antibody (ab243521)
Paraffin-embedded human testis tissue stained for NUBP1 using ab243521 at 1/200 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NUBP1 antibody (ab243521)
Paraffin-embedded human liver tissue stained for NUBP1 using ab243521 at 1/200 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab243521 has not yet been referenced specifically in any publications.