Overview

  • Product name

    Anti-NUBP2 antibody
  • Description

    Rabbit polyclonal to NUBP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human NUBP2 aa 54-170.
    Sequence:

    CGPSIPRMLGAQGRAVHQCDRGWAPVFLDREQSISLMSVGFLLEKPDEAV VWRGPKKNALIKQFVSDVAWGELDYLVVDTPPGTSDEHMATIEALRPYQP LGALVVTTPQAVSVGDV


    Database link: Q9Y5Y2

  • Positive control

    • IHC-P: Human adrenal gland tissue. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab238892 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/20 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Function

    Component of the cytosolic iron-sulfur (Fe/S) protein assembly (CIA) machinery. Required for maturation of extramitochondrial Fe-S proteins. The NUBP1-NUBP2 heterotetramer forms a Fe-S scaffold complex, mediating the de novo assembly of an Fe-S cluster and its transfer to target apoproteins.
  • Tissue specificity

    Widely expressed with highest expression in skeletal muscle.
  • Sequence similarities

    Belongs to the Mrp/NBP35 ATP-binding proteins family. NUBP2/CFD1 subfamily.
  • Developmental stage

    Expressed in fetal brain, lung, liver and kidney.
  • Cellular localization

    Nucleus. Cytoplasm > cytoskeleton > microtubule organizing center > centrosome. Enriched at the centrosomes during mitosis.
  • Information by UniProt
  • Database links

  • Alternative names

    • C447E6.1 (nucleotide binding protein 1 (E.coli MinD like) ) antibody
    • CFD1 antibody
    • Cytosolic Fe-S cluster assembly factor NUBP2 antibody
    • D17Wsu11e antibody
    • Homolog of yeast cytosolic FeS cluster deficient 1 antibody
    • NBP 2 antibody
    • NUBP1 antibody
    • Nubp2 antibody
    • NUBP2_HUMAN antibody
    • Nucleotide binding protein 2 (E.coli MinD like) antibody
    • Nucleotide binding protein 2 (MinD homolog, E. coli) antibody
    • Nucleotide binding protein 2 antibody
    • Nucleotide-binding protein 2 antibody
    see all

Images

  • Paraffin-embedded human adrenal gland tissue stained for NUBP2 with ab238892 at a 1/100 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • HeLa (Human epithelial cell line from cervix adenocarcinoma) cells stained for NUBP2 (Green) using ab238892 at a 1/33 dilution in ICC/IF.

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the primary antibody overnight at 4°C. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L). Counterstained with DAPI (Blue).

References

ab238892 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238892.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up