Overview

  • Product name

  • Description

    Rabbit polyclonal to NUBPL
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Human NUBPL aa 39-319. Full length mature chain without transit peptide.
    Sequence:

    GAGSETLKQRRTQIMSRGLPKQKPIEGVKQVIVVASGKGGVGKSTTAVNL ALALAANDSSKAIGLLDVDVYGPSVPKMMNLKGNPELSQSNLMRPLLNYG IACMSMGFLVEESEPVVWRGLMVMSAIEKLLRQVDWGQLDYLVVDMPPGT GDVQLSVSQNIPITGAVIVSTPQDIALMDAHKGAEMFRRVHVPVLGLVQN MSVFQCPKCKHKTHIFGADGARKLAQTLGLEVLGDIPLHLNIREASDTGQ PIVFSQPESDEAKAYLRIAVEVVRRLPSPSE


    Database link: Q8TB37-1

  • Positive control

    • WB: A431 whole cell lysate. IHC-P: Human colon cancer and liver cancer tissue.
  • General notes

    Previously labelled as Nucleotide binding protein like.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235924 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000.
IHC-P 1/20 - 1/200.

Target

  • Function

    Required for the assembly of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). May deliver of one or more Fe-S clusters to complex I subunits.
  • Tissue specificity

    Highest expression in liver and kidney. expressed at significant levels in small intestine and brain (at protein level).
  • Involvement in disease

    Defects in NUBPL are a cause of mitochondrial complex I deficiency (MT-C1D) [MIM:252010]. A disorder of the mitochondrial respiratory chain that causes a wide range of clinical manifestations from lethal neonatal disease to adult-onset neurodegenerative disorders. Phenotypes include macrocephaly with progressive leukodystrophy, non-specific encephalopathy, cardiomyopathy, myopathy, liver disease, Leigh syndrome, Leber hereditary optic neuropathy, and some forms of Parkinson disease.
  • Sequence similarities

    Belongs to the Mrp/NBP35 ATP-binding proteins family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • C14orf127 antibody
    • FLJ12660 antibody
    • huInd1 antibody
    • IND1 homolog antibody
    • Iron-sulfur protein NUBPL antibody
    • Nubpl antibody
    • NUBPL_HUMAN antibody
    • nucleotide binding protein like antibody
    • Nucleotide-binding protein-like antibody
    see all

Images

  • Anti-NUBPL antibody (ab235924) at 1/500 dilution + A431 (Human epidermoid carcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution
  • Paraffin-embedded human colon cancer tissue stained for NUBPL with ab235924 (1/100 dilution) in immunohistochemical analysis.

  • Paraffin-embedded human liver cancer tissue stained for NUBPL with ab235924 (1/100 dilution) in immunohistochemical analysis.

References

ab235924 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235924.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up