Overview

  • Product name

  • Description

    Rabbit polyclonal to NUCB2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human NUCB2 aa 25-106.
    Sequence:

    VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREK LQKADIEEIKSGRLSKELDLVSHHVRTKLDEL


    Database link: P80303

  • Positive control

    • WB: Rat brain and heart lysates; Mouse heart, liver and brain lysates. IHC-P: Human prostate cancer tissue.
  • General notes

    Previously labelled as Nucleobindin 2. 

Properties

Applications

Our Abpromise guarantee covers the use of ab223123 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 51 kDa (predicted molecular weight: 50 kDa).
IHC-P 1/20 - 1/200.

Target

Images

  • Paraffin-embedded human prostate cancer tissue stained for NUCB2 using ab223123 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-NUCB2 antibody (ab223123) at 1/500 dilution

    Lane 1 : Rat brain lysate
    Lane 2 : Rat heart lysate
    Lane 3 : Mouse heart lysate
    Lane 4 : Mouse liver lysate
    Lane 5 : Mouse brain lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 50 kDa
    Observed band size: 51 kDa
    why is the actual band size different from the predicted?

References

ab223123 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223123.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up