Overview

  • Product name

  • Description

    Rabbit polyclonal to NUCB2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human NUCB2 aa 302-418.
    Sequence:

    MSEVDTNKDRLVTLEEFLKATEKKEFLEPDSWETLDQQQFFTEEELKEYE NIIALQENELKKKADELQKQKEELQRQHDQLEAQKLEYHQVIQQMEQKKL QQGIPPSGPAGELKFEPR


    Database link: P80303

  • Positive control

    • WB: HL-60 and NBT-II cell lysate. IHC-P: Human stomach tissue. ICC/IF: U-2 OS cells.
  • General notes

    Previously labelled as Nucleobindin 2. 

Properties

Applications

Our Abpromise guarantee covers the use of ab224348 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 50 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Calcium-binding protein. May have a role in calcium homeostasis.
  • Tissue specificity

    Predominantly expressed in spleen, testis and normal stomach.
  • Sequence similarities

    Belongs to the nucleobindin family.
    Contains 2 EF-hand domains.
  • Cellular localization

    Membrane. Cytoplasm. Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • DNA binding protein NEFA antibody
    • DNA-binding protein NEFA antibody
    • Gastric cancer antigen Zg4 antibody
    • HEL S 109 antibody
    • NEFA antibody
    • Nefastin 1 antibody
    • Nefastin-1 antibody
    • Nefastin1 antibody
    • Nucb2 antibody
    • NUCB2_HUMAN antibody
    • Nucleobindin 2 antibody
    • Nucleobindin-2 antibody
    • Nucleobinding 2 antibody
    • Prepronefastin antibody
    • Prepronesfatin antibody
    see all

Images

  • Paraffin-embedded human stomach tissue stained for NUCB2 using ab224348 at 1/1000 in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for NUCB2 (green) using ab224348 at 4 µg/ml in ICC/IF.

  • All lanes : Anti-NUCB2 antibody (ab224348) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embryonic fibroblast cell line) cell lysate
    Lane 2 : NBT-II cell lysate

    Developed using the ECL technique.

    Predicted band size: 50 kDa

  • Anti-NUCB2 antibody (ab224348) at 1/100 dilution + HL-60 (human promyelocytic leukemia cell line) cell lysate

    Developed using the ECL technique.

    Predicted band size: 50 kDa

References

This product has been referenced in:

  • Zhao J  et al. High expression of NUCB2 promotes papillary thyroid cancer cells proliferation and invasion. Onco Targets Ther 12:1309-1318 (2019). Read more (PubMed: 30863097) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224348.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up