Anti-Nucleoporin p62/NUP62 antibody [2A] (ab188413)
Key features and details
- Rat monoclonal [2A] to Nucleoporin p62/NUP62
- Suitable for: WB, ICC/IF
- Reacts with: Human, African green monkey
- Isotype: IgG1
Overview
-
Product name
Anti-Nucleoporin p62/NUP62 antibody [2A]
See all Nucleoporin p62/NUP62 primary antibodies -
Description
Rat monoclonal [2A] to Nucleoporin p62/NUP62 -
Host species
Rat -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Human, African green monkey
Does not react with: Mouse -
Immunogen
Recombinant fragment (His-tag) corresponding to Human Nucleoporin p62/NUP62 aa 1-300. (N terminal proprietary tag).
Sequence:MSGFNFGGTGAPTGGFTFGTAKTATTTPATGFSFSTSGTGGFNFGAPFQP ATSTPSTGLFSLATQTPATQTTGFTFGTATLASGGTGFSLGIGASKLNLS NTAATPAMANPSGFGLGSSNLTNAISSTVTSSQGTAPTGFVFGPSTTSVA PATTSGGFSFTGGSTAQPSGFNIGSAGNSAQPTAPATLPFTPATPAATTA GATQPAAPTPTATITSTGPSLFASIATAPTSSATTGLSLCTPVTTAGAPT AGTQGFSLKAPGAASGTSTTTSTAATATATTTSSSSTTGFALNLKPLAPA
Database link: P37198 -
Epitope
aa 1-179 (FG-repeat region) -
Positive control
- HeLa cells and Cos cells.
-
General notes
This product was previously labelled as Nucleoporin p62
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6
Constituents: 50% Glycerol (glycerin, glycerine), 50% PBS -
Concentration information loading...
-
Purity
Proprietary Purification -
Purification notes
ab188413 was purified from serum-free culture medium of the hybridoma. -
Clonality
Monoclonal -
Clone number
2A -
Isotype
IgG1 -
Light chain type
kappa -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab188413 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/2000. Detects a band of approximately 60 kDa (predicted molecular weight: 53 kDa). | |
ICC/IF | 1/400. |
Target
-
Relevance
The nuclear pore complex is a structure that extends across the nuclear envelope and regulates the flow of macromolecules between the cytoplasm and the nucleus. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. Nup 62 is localized to the nuclear pore central plug. This protein associates with the importin alpha/beta complex which is involved in the import of proteins containing nuclear localization signals. There are multiple transcript variants of this gene, however, they encode a single protein isoform. This protein undergoes post-translational modifications. It contains about 10 N-acetylglucosamine side chain sites. -
Cellular localization
Nucleus; nuclear pore complex. Cytoplasm; cytoskeleton; spindle pole. Note: Central region of the nuclear pore, within the transporter. During mitotic cell division, it associates with the poles of the mitotic spindle. -
Database links
- Entrez Gene: 23636 Human
- Omim: 605815 Human
- SwissProt: P37198 Human
- Unigene: 574492 Human
-
Alternative names
- 62 kDa nucleoporin antibody
- DKFZp547L134 antibody
- FLJ20822 antibody
see all
Images
-
Anti-Nucleoporin p62/NUP62 antibody [2A] (ab188413) at 1/500 dilution + HeLa nuclear membrane lysate
Secondary
Alkaline phosphatase-conjugated anti-rat IgG
Predicted band size: 53 kDa
Observed band size: 60 kDa why is the actual band size different from the predicted? -
Immunofluorescent analysis of HeLa cells labeling Nucleoporin p62/NUP62 with ab188413 at 1/400 dilution, followed by Alexa Fluor®488-conjugated goat anti-rat IgG secondary antibody at 1/500 dilution. HeLa cells were fixed with 3.7% formaldehyde and
permeabilized with 0.5% Triton X-100. -
Immunofluorescent analysis of HeLa cells, labeling Nucleoporin p62/NUP62 with ab188413 at 1/400 dilution, followed by Alexa Fluor®488-conjugated goat anti-rat IgG secondary antibody at 1/500 dilution. HeLa cells were fixed with 3.7% formaldehyde and
permeabilized with 0.5% Triton X-100.
Protocols
Datasheets and documents
References (4)
ab188413 has been referenced in 4 publications.
- Heusel M et al. A Global Screen for Assembly State Changes of the Mitotic Proteome by SEC-SWATH-MS. Cell Syst 10:133-155.e6 (2020). PubMed: 32027860
- Fišerová J et al. Nuclear pore protein TPR associates with lamin B1 and affects nuclear lamina organization and nuclear pore distribution. Cell Mol Life Sci 76:2199-2216 (2019). PubMed: 30762072
- Fišerová J et al. Chromatin organization at the nuclear periphery as revealed by image analysis of structured illumination microscopy data. J Cell Sci 130:2066-2077 (2017). PubMed: 28476938
- Linder MI et al. Mitotic Disassembly of Nuclear Pore Complexes Involves CDK1- and PLK1-Mediated Phosphorylation of Key Interconnecting Nucleoporins. Dev Cell 43:141-156.e7 (2017). PubMed: 29065306