For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    nucleoporin-p62nup62-antibody-2a-ab188413.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cell Biology Apoptosis Nucleus Other
Share by email

Anti-Nucleoporin p62/NUP62 antibody [2A] (ab188413)

  • Datasheet
Submit a review Submit a question References (4)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-Nucleoporin p62/NUP62 antibody [2A] (ab188413)
  • Immunocytochemistry/ Immunofluorescence - Anti-Nucleoporin p62/NUP62 antibody [2A] (ab188413)
  • Immunocytochemistry/ Immunofluorescence - Anti-Nucleoporin p62/NUP62 antibody [2A] (ab188413)

Key features and details

  • Rat monoclonal [2A] to Nucleoporin p62/NUP62
  • Suitable for: WB, ICC/IF
  • Reacts with: Human, African green monkey
  • Isotype: IgG1

You may also be interested in

Biochemical
(Z)-4-Hydroxytamoxifen, estrogen receptor modulator (ab141943)
Primary
Product image
Anti-Ran antibody [EPR10791(B)] (ab155103)
Protein
Product image
Recombinant Human Nucleoporin p62/NUP62 protein (ab161728)

View more associated products

Overview

  • Product name

    Anti-Nucleoporin p62/NUP62 antibody [2A]
    See all Nucleoporin p62/NUP62 primary antibodies
  • Description

    Rat monoclonal [2A] to Nucleoporin p62/NUP62
  • Host species

    Rat
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human, African green monkey
    Does not react with: Mouse
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human Nucleoporin p62/NUP62 aa 1-300. (N terminal proprietary tag).
    Sequence:

    MSGFNFGGTGAPTGGFTFGTAKTATTTPATGFSFSTSGTGGFNFGAPFQP ATSTPSTGLFSLATQTPATQTTGFTFGTATLASGGTGFSLGIGASKLNLS NTAATPAMANPSGFGLGSSNLTNAISSTVTSSQGTAPTGFVFGPSTTSVA PATTSGGFSFTGGSTAQPSGFNIGSAGNSAQPTAPATLPFTPATPAATTA GATQPAAPTPTATITSTGPSLFASIATAPTSSATTGLSLCTPVTTAGAPT AGTQGFSLKAPGAASGTSTTTSTAATATATTTSSSSTTGFALNLKPLAPA


    Database link: P37198
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Epitope

    aa 1-179 (FG-repeat region)
  • Positive control

    • HeLa cells and Cos cells.
  • General notes

     This product was previously labelled as Nucleoporin p62

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 6
    Constituents: 50% Glycerol (glycerin, glycerine), 50% PBS
  • Concentration information loading...
  • Purity

    Proprietary Purification
  • Purification notes

    ab188413 was purified from serum-free culture medium of the hybridoma.
  • Clonality

    Monoclonal
  • Clone number

    2A
  • Isotype

    IgG1
  • Light chain type

    kappa
  • Research areas

    • Cell Biology
    • Apoptosis
    • Nucleus
    • Other
    • Tags & Cell Markers
    • Subcellular Markers
    • Nucleus
    • Nuclear Pore
    • Signal Transduction
    • Signaling Pathway
    • Nuclear Signaling
    • NFkB Pathway
    • Signal Transduction
    • Growth Factors/Hormones
    • EGF
    • Signal Transduction
    • Protein Trafficking
    • Nuclear Import / Export
    • Epigenetics and Nuclear Signaling
    • Nuclear Signaling Pathways
    • Nuclear Receptors
    • Nuclear Pore Complex
    • Cancer
    • Cell Death
    • Apoptosis
    • Nucleus
    • Other

Associated products

  • Compatible Secondaries

    • Goat Anti-Rat IgG H&L (Alexa Fluor® 488) (ab150157)
    • Goat Anti-Rat IgG H&L (HRP) (ab205720)
  • Isotype control

    • Rat IgG1, kappa monoclonal [RTK2071] - Isotype control (ab18412)
  • Recombinant Protein

    • Recombinant Human Nucleoporin p62/NUP62 protein (ab161728)
  • Related Products

    • Recombinant Human Nucleoporin p62/NUP62 protein (ab161728)

Applications

Our Abpromise guarantee covers the use of ab188413 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Detects a band of approximately 60 kDa (predicted molecular weight: 53 kDa).
ICC/IF 1/400.

Target

  • Relevance

    The nuclear pore complex is a structure that extends across the nuclear envelope and regulates the flow of macromolecules between the cytoplasm and the nucleus. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. Nup 62 is localized to the nuclear pore central plug. This protein associates with the importin alpha/beta complex which is involved in the import of proteins containing nuclear localization signals. There are multiple transcript variants of this gene, however, they encode a single protein isoform. This protein undergoes post-translational modifications. It contains about 10 N-acetylglucosamine side chain sites.
  • Cellular localization

    Nucleus; nuclear pore complex. Cytoplasm; cytoskeleton; spindle pole. Note: Central region of the nuclear pore, within the transporter. During mitotic cell division, it associates with the poles of the mitotic spindle.
  • Database links

    • Entrez Gene: 23636 Human
    • Omim: 605815 Human
    • SwissProt: P37198 Human
    • Unigene: 574492 Human
    • Alternative names

      • 62 kDa nucleoporin antibody
      • DKFZp547L134 antibody
      • FLJ20822 antibody
      • FLJ43869 antibody
      • IBSN antibody
      • MGC841 antibody
      • Nuclear pore glycoprotein p62 antibody
      • nucleoporin 62kDa antibody
      • Nucleoporin Nup62 antibody
      • nucleoporin p62 antibody
      • nucleoporin p62KD antibody
      • NUP62 antibody
      • NUP62 protein antibody
      • p62 antibody
      • SNDI antibody
      see all

    Images

    • Western blot - Anti-Nucleoporin p62/NUP62 antibody [2A] (ab188413)
      Western blot - Anti-Nucleoporin p62/NUP62 antibody [2A] (ab188413)
      Anti-Nucleoporin p62/NUP62 antibody [2A] (ab188413) at 1/500 dilution + HeLa nuclear membrane lysate

      Secondary
      Alkaline phosphatase-conjugated anti-rat IgG

      Predicted band size: 53 kDa
      Observed band size: 60 kDa
      why is the actual band size different from the predicted?

    • Immunocytochemistry/ Immunofluorescence - Anti-Nucleoporin p62/NUP62 antibody [2A] (ab188413)
      Immunocytochemistry/ Immunofluorescence - Anti-Nucleoporin p62/NUP62 antibody [2A] (ab188413)

      Immunofluorescent analysis of HeLa cells labeling Nucleoporin p62/NUP62 with ab188413 at 1/400 dilution, followed by Alexa Fluor®488-conjugated goat anti-rat IgG secondary antibody at 1/500 dilution. HeLa cells were fixed with 3.7% formaldehyde and
      permeabilized with 0.5% Triton X-100.

    • Immunocytochemistry/ Immunofluorescence - Anti-Nucleoporin p62/NUP62 antibody [2A] (ab188413)
      Immunocytochemistry/ Immunofluorescence - Anti-Nucleoporin p62/NUP62 antibody [2A] (ab188413)

      Immunofluorescent analysis of HeLa cells, labeling Nucleoporin p62/NUP62 with ab188413 at 1/400 dilution, followed by Alexa Fluor®488-conjugated goat anti-rat IgG secondary antibody at 1/500 dilution. HeLa cells were fixed with 3.7% formaldehyde and
      permeabilized with 0.5% Triton X-100.

    Protocols

    • Western blot protocols
    • Immunocytochemistry & immunofluorescence protocols

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (4)

    Publishing research using ab188413? Please let us know so that we can cite the reference in this datasheet.

    ab188413 has been referenced in 4 publications.

    • Heusel M  et al. A Global Screen for Assembly State Changes of the Mitotic Proteome by SEC-SWATH-MS. Cell Syst 10:133-155.e6 (2020). PubMed: 32027860
    • Fišerová J  et al. Nuclear pore protein TPR associates with lamin B1 and affects nuclear lamina organization and nuclear pore distribution. Cell Mol Life Sci 76:2199-2216 (2019). PubMed: 30762072
    • Fišerová J  et al. Chromatin organization at the nuclear periphery as revealed by image analysis of structured illumination microscopy data. J Cell Sci 130:2066-2077 (2017). PubMed: 28476938
    • Linder MI  et al. Mitotic Disassembly of Nuclear Pore Complexes Involves CDK1- and PLK1-Mediated Phosphorylation of Key Interconnecting Nucleoporins. Dev Cell 43:141-156.e7 (2017). PubMed: 29065306

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab188413.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.