Anti-Nucleoporin p62/NUP62 antibody [2A] (ab188413)

Submit a review Submit a question References (3)

Overview

  • Product name

    Anti-Nucleoporin p62/NUP62 antibody [2A]
    See all Nucleoporin p62/NUP62 primary antibodies

  • Description

    Rat monoclonal [2A] to Nucleoporin p62/NUP62

  • Host species

    Rat

  • Tested applications

    Suitable for: WB, IP, ICC/IFmore details

  • Species reactivity

    Reacts with: Human, African green monkey
    Does not react with: Mouse

  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human Nucleoporin p62/NUP62 aa 1-300. (N terminal proprietary tag).
    Sequence:

    MSGFNFGGTGAPTGGFTFGTAKTATTTPATGFSFSTSGTGGFNFGAPFQP ATSTPSTGLFSLATQTPATQTTGFTFGTATLASGGTGFSLGIGASKLNLS NTAATPAMANPSGFGLGSSNLTNAISSTVTSSQGTAPTGFVFGPSTTSVA PATTSGGFSFTGGSTAQPSGFNIGSAGNSAQPTAPATLPFTPATPAATTA GATQPAAPTPTATITSTGPSLFASIATAPTSSATTGLSLCTPVTTAGAPT AGTQGFSLKAPGAASGTSTTTSTAATATATTTSSSSTTGFALNLKPLAPA


    Database link: P37198

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Epitope

    aa 1-179 (FG-repeat region)

  • Positive control

    • HeLa cells and Cos cells.

  • General notes

     This product was previously labelled as Nucleoporin p62

     

Properties

Applications

Our Abpromise guarantee covers the use of ab188413 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Detects a band of approximately 60 kDa (predicted molecular weight: 53 kDa).
IP Use at an assay dependent concentration.
ICC/IF 1/400.

Target

  • Relevance

    The nuclear pore complex is a structure that extends across the nuclear envelope and regulates the flow of macromolecules between the cytoplasm and the nucleus. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. Nup 62 is localized to the nuclear pore central plug. This protein associates with the importin alpha/beta complex which is involved in the import of proteins containing nuclear localization signals. There are multiple transcript variants of this gene, however, they encode a single protein isoform. This protein undergoes post-translational modifications. It contains about 10 N-acetylglucosamine side chain sites.

  • Cellular localization

    Nucleus; nuclear pore complex. Cytoplasm; cytoskeleton; spindle pole. Note: Central region of the nuclear pore, within the transporter. During mitotic cell division, it associates with the poles of the mitotic spindle.

  • Database links

    • Alternative names

      • 62 kDa nucleoporin antibody
      • DKFZp547L134 antibody
      • FLJ20822 antibody
      • FLJ43869 antibody
      • IBSN antibody
      • MGC841 antibody
      • Nuclear pore glycoprotein p62 antibody
      • nucleoporin 62kDa antibody
      • Nucleoporin Nup62 antibody
      • nucleoporin p62 antibody
      • nucleoporin p62KD antibody
      • NUP62 antibody
      • NUP62 protein antibody
      • p62 antibody
      • SNDI antibody
      see all

    Images

    • Western blot - Anti-Nucleoporin p62/NUP62 antibody [2A] (ab188413)
      Western blot - Anti-Nucleoporin p62/NUP62 antibody [2A] (ab188413)
      Anti-Nucleoporin p62/NUP62 antibody [2A] (ab188413) at 1/500 dilution + HeLa nuclear membrane lysate

      Secondary
      Alkaline phosphatase-conjugated anti-rat IgG

      Predicted band size: 53 kDa
      Observed band size: 60 kDa
      why is the actual band size different from the predicted?

    • Immunocytochemistry/ Immunofluorescence - Anti-Nucleoporin p62/NUP62 antibody [2A] (ab188413)
      Immunocytochemistry/ Immunofluorescence - Anti-Nucleoporin p62/NUP62 antibody [2A] (ab188413)

      Immunofluorescent analysis of HeLa cells labeling Nucleoporin p62/NUP62 with ab188413 at 1/400 dilution, followed by Alexa Fluor®488-conjugated goat anti-rat IgG secondary antibody at 1/500 dilution. HeLa cells were fixed with 3.7% formaldehyde and
      permeabilized with 0.5% Triton X-100.

    • Immunocytochemistry/ Immunofluorescence - Anti-Nucleoporin p62/NUP62 antibody [2A] (ab188413)
      Immunocytochemistry/ Immunofluorescence - Anti-Nucleoporin p62/NUP62 antibody [2A] (ab188413)

      Immunofluorescent analysis of HeLa cells, labeling Nucleoporin p62/NUP62 with ab188413 at 1/400 dilution, followed by Alexa Fluor®488-conjugated goat anti-rat IgG secondary antibody at 1/500 dilution. HeLa cells were fixed with 3.7% formaldehyde and
      permeabilized with 0.5% Triton X-100.

    References

    This product has been referenced in:

    • Fišerová J  et al. Nuclear pore protein TPR associates with lamin B1 and affects nuclear lamina organization and nuclear pore distribution. Cell Mol Life Sci 76:2199-2216 (2019). Read more (PubMed: 30762072) »
    • Fišerová J  et al. Chromatin organization at the nuclear periphery as revealed by image analysis of structured illumination microscopy data. J Cell Sci 130:2066-2077 (2017). Read more (PubMed: 28476938) »
    See all 3 Publications for this product

    Publishing research using ab188413? Please let us know so that we can cite the reference in this datasheet.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab188413.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com