Overview

  • Product name

    Anti-Nucleoside Diphosphate Kinase 7 antibody
    See all Nucleoside Diphosphate Kinase 7 primary antibodies
  • Description

    Rabbit polyclonal to Nucleoside Diphosphate Kinase 7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human Nucleoside Diphosphate Kinase 7 aa 191-280.
    Sequence:

    SIRALFGTDGIRNAAHGPDSFASAAREMELFFPSSGGCGPANTAKFTNCT CCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVN


    Database link: Q9Y5B8

  • Positive control

    • ICC/IF: U-251 MG cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220753 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

Images

  • Immunofluorescent analysis of paraformaldehyde-fixed, Triton X-100 permeabilized U-251 MG cells labeling Nucleoside Diphosphate Kinase 7 with ab220753 at 4 μg/mL dilution (green). 

References

ab220753 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220753.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up