Overview

  • Product name

    Anti-Nucleoside-diphosphate kinase antibody
    See all Nucleoside-diphosphate kinase primary antibodies
  • Description

    Rabbit polyclonal to Nucleoside-diphosphate kinase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Pig
  • Immunogen

    Recombinant fragment corresponding to Human Nucleoside-diphosphate kinase aa 37-196.
    Sequence:

    LLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQK NKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGK SSGRSDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKKIDASKSVDEVFD EVVQIFDKEG


    Database link: P30085-1

  • Positive control

    • WB: HEK-293T and HeLa whole cell lysates. IHC-P: Human colon cancer tissue.
  • General notes

     This product was previously labelled as UMP/CMP kinase

     

Properties

Applications

Our Abpromise guarantee covers the use of ab225940 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 22 kDa.

Target

Images

  • Paraffin-embedded human colon cancer tissue stained for Nucleoside-diphosphate kinase using ab225940 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-Nucleoside-diphosphate kinase antibody (ab225940) at 1/1000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit at 1/10000 dilution

    Predicted band size: 22 kDa
    Observed band size: 22 kDa

References

ab225940 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225940.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up