Overview

  • Product name

  • Description

    Rabbit polyclonal to NUDT15
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human NUDT15 aa 86-164.
    Sequence:

    EKENYHYVTILMKGEVDVTHDSEPKNVEPEKNESWEWVPWEELPPLDQLF WGLRCLKEQGYDPFKEDLNHLVGYKGNHL


    Database link: Q9NV35

  • Positive control

    • IHC-P: Human duodenum tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab247010 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Mediates the hydrolysis of some nucleoside diphosphate derivatives. Can degrade 8-oxo-dGTP in vitro, suggesting that it may remove an oxidatively damaged form of guanine (7,8-dihydro-8-oxoguanine) from DNA and the nucleotide pool, thereby preventing misincorporation of 8-oxo-dGTP into DNA thus preventing A:T to C:G transversions. Its substrate specificity in vivo however remains unclear (By similarity). May have a role in DNA synthesis and cell cycle progression throught the interaction with PCNA.
  • Sequence similarities

    Belongs to the Nudix hydrolase family.
    Contains 1 nudix hydrolase domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • 8-dihydro-8-oxoguanine triphosphatase NUDT15 antibody
    • 8-oxo-dGTPase NUDT15 antibody
    • A730068G11Rik antibody
    • EC 3.1.6.- antibody
    • FLJ10956 antibody
    • MGC104352 antibody
    • MTH2 antibody
    • MutT homolog 2 antibody
    • Nucleoside diphosphate-linked moiety X motif 15 antibody
    • NUD15_HUMAN antibody
    • Nudix (nucleoside diphosphate linked moiety X)-type motif antibody
    • Nudix motif 15 antibody
    • NUDT15 antibody
    • OTTHUMP00000018389 antibody
    • Probable 7 antibody
    • Probable 7,8-dihydro-8-oxoguanine triphosphatase NUDT15 antibody
    • RP11-90M2.1 antibody
    see all

Images

  • Paraffin-embedded human duodenum tissue stained for NUDT15 using ab247010 at 1/1000 dilution in immunohistochemical analysis.

References

ab247010 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab247010.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up