Overview

  • Product name

  • Description

    Rabbit polyclonal to NUDT2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human NUDT2 aa 1-147.
    Sequence:

    MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGED DLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKD YDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA


    Database link: P50583

  • Positive control

    • IHC-P: Human breast cancer and tonsil tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224665 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Asymmetrically hydrolyzes Ap4A to yield AMP and ATP. Plays a major role in maintaining homeostasis.
  • Sequence similarities

    Belongs to the Nudix hydrolase family.
    Contains 1 nudix hydrolase domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2310051L06Rik antibody
    • 5''''-P1 antibody
    • AA939917 antibody
    • Ap4A hydrolase 1 antibody
    • Ap4A hydrolase antibody
    • AP4A_HUMAN antibody
    • Ap4Aase antibody
    • APAH 1 antibody
    • APAH1 antibody
    • Bis(5' nucleosyl) tetraphosphatase [asymmetrical] antibody
    • Bis(5''-nucleosyl)-tetraphosphatase [asymmetrical] antibody
    • Diadenosine 5'' antibody
    • Diadenosine 5',5''' P1,P4 tetraphosphate asymmetrical hydrolase antibody
    • Diadenosine 5',5''-P1,P4-tetraphosphate pyrophosphohydrolase antibody
    • Diadenosine tetraphosphatase antibody
    • EC 3.6.1.17 antibody
    • MGC10404 antibody
    • Nucleoside diphosphate linked moiety X motif 2 antibody
    • Nucleoside diphosphate-linked moiety X motif 2 antibody
    • nudix (nucleoside diphosphate linked moiety X)-type motif 2 antibody
    • Nudix motif 2 antibody
    • Nudix-type motif 2 antibody
    • NUDT 2 antibody
    • NUDT2 antibody
    • OTTHUMP00000021256 antibody
    • OTTHUMP00000021257 antibody
    • OTTHUMP00000021258 antibody
    • OTTHUMP00000021259 antibody
    • P4-tetraphosphate asymmetrical hydrolase antibody
    see all

Images

  • Paraffin-embedded human tonsil tissue stained for NUDT2 using ab224665 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human breast cancer tissue stained for NUDT2 using ab224665 at 1/100 dilution in immunohistochemical analysis.

References

ab224665 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224665.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up