Overview

  • Product name

    Anti-NUDT21/CFIM25 antibody
    See all NUDT21/CFIM25 primary antibodies
  • Description

    Rabbit polyclonal to NUDT21/CFIM25
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Drosophila melanogaster, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human NUDT21/CFIM25 aa 37-86 (internal sequence).
    Sequence:

    INLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIV

  • Positive control

    • HepG2 cell lysate Human intestine tissue
  • General notes

     This product was previously labelled as NUDT21

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab66667 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1.25 µg/ml. Detects a band of approximately 26 kDa (predicted molecular weight: 26 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 4 - 8 µg/ml.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/312500.

Target

  • Function

    Component of the cleavage factor Im (CFIm) complex that plays a key role in pre-mRNA 3'-processing. Involved in association with CPSF6 or CPSF7 in pre-MRNA 3'-end poly(A) site cleavage and poly(A) addition. NUDT21/CPSF5 binds to cleavage and polyadenylation RNA substrates. The homodimer mediates simultaneous sequence-specific recognition of two 5'-UGUA-3' elements within the pre-mRNA. Binds to, but does not hydrolyze mono- and di-adenosine nucleotides. May have a role in mRNA export.
  • Sequence similarities

    Belongs to the Nudix hydrolase family. CPSF5 subfamily.
    Contains 1 nudix hydrolase domain.
  • Post-translational
    modifications

    Acetylated mainly by p300/CBP, recruited to the complex by CPSF6. Acetylation decreases interaction with PAPAO. Deacetylated by the class I/II HDACs, HDAC1, HDAC3 and HDAC10, and by the class III HDACs, SIRT1 AND SIRT2.
  • Cellular localization

    Nucleus. In punctate subnuclear structures localized adjacent to nuclear speckles, called paraspeckles.
  • Information by UniProt
  • Database links

  • Alternative names

    • CFIM 25 antibody
    • CFIM25 antibody
    • Cleavage and polyadenylation specific factor 5 25 kD subunit antibody
    • Cleavage and polyadenylation specific factor 5 25 kDa antibody
    • Cleavage and polyadenylation specific factor 5 antibody
    • Cleavage and polyadenylation specificity factor 25 kDa subunit antibody
    • Cleavage and polyadenylation specificity factor subunit 5 antibody
    • Cleavage factor Im complex 25 kDa subunit antibody
    • CPSF 25 antibody
    • CPSF 25 kDa subunit antibody
    • CPSF 5 antibody
    • CPSF25 antibody
    • CPSF5 antibody
    • CPSF5_HUMAN antibody
    • DKFZp686H1588 antibody
    • Nucleoside diphosphate linked moiety X motif 21 antibody
    • Nucleoside diphosphate-linked moiety X motif 21 antibody
    • Nudix (nucleoside diphosphate linked moiety X) type motif 21 antibody
    • Nudix hydrolase 21 antibody
    • Nudix motif 21 antibody
    • NUDT 21 antibody
    • Nudt21 antibody
    • Pre mRNA cleavage factor Im (25kD) antibody
    • Pre mRNA cleavage factor Im 25 kDa subunit antibody
    • Pre mRNA cleavage factor Im 25kD subunit antibody
    • Pre-mRNA cleavage factor Im 25 kDa subunit antibody
    see all

Images

  • All lanes : Anti-NUDT21/CFIM25 antibody (ab66667) at 1.25 µg/ml

    Lane 1 : Marker
    Lane 2 : HepG2 cell lysate at 10 µg

    Secondary
    All lanes : HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 26 kDa
    Observed band size: 26 kDa
    Additional bands at: 65 kDa. We are unsure as to the identity of these extra bands.



    Gel concentration: 12%
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human intestine tissue labelling NUDT21/CFIM25 with ab6667 at 4-8µg/ml. Arrows indicate positively labelled epithelial cells of the intestinal villus. Magnification: 400X.

References

ab66667 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Answer

According to our records, ab56856 was proving difficult to use in WB and we were in contact in order to help resolve the issue.

Looking at our correspondence, it appears that we are awaiting more details in order to help us better understand the difficulties experienced. If the requested information has already been sent, it appears that it did not reach our Scientific Support team and we apologize for this inconvenience. In this case we would like to ask for the information again so that we can reach a resolution.

If the issue has already been settled, please let us know so that we can be assured that the problem has been solved to your satisfaction and update our records.

We wish you the best of luck with your research and look forward to a reply.

Read More

Answer

Thank you for your email. I am sorry to hear that you have been experiencing problems with this antibody.

I have read the details, you have kindly provided and have few suggestions; these might improve the results.

- NUDT21 as per http://www.genecards.org/cgi-bin/carddisp.pl?gene=NUDT21exist as a component of the cleavage factor Im (CFIm) complex, composed of, at least, NUDT21/CPSF5 and CPSF6 or CPSF7. Within the cleavage factor Im complex, the NUDT21/CPSF5 homodimer is at the core of a heterotetramer. It is likely that the band at 55 kDa is a homodimeric form of NUDT21 however if the protein has been reduced without a doubt then the possibility of this being a homodimer can be ruled out. Could you however try heating the lysates at 100C for 10 minutes and carefully checking the reducing agents used?

- The NUDT21 protein is also heavily glycosylated so the observed band size (perhaps faint 40kDa band) would be different than predicted. (http://www.uniprot.org/uniprot/O43809). We have observed 26kDa band size in A-431 cell line though so this cell line lysates might be used as positive control.

I hope these suggestions will help to improve results. Please let me know if the results do not improve, I well then send you a replacement antibody ab66667.

Thank you very much for your cooperation. I will look forward to hearing from you soon.

Read More

Answer

Thank you for contacting us.

I am sorry to hear you are experiencing difficulties with one of our products. We take product complaints very seriously, and investigate every product that we feel may not be performing correctly.

I am attaching our questionnaire so that we can gather further information regarding the samples tested and the protocol used. Once we receive the completed questionnaire, we will look at the protocol and see if there are any suggestions we can make that may improve the results. This information will also allow us to investigate this case internally and initiate additional testing where necessary. If the product was purchased in the last six months and is being used according to our Abpromise, we would be happy to replace or refund the antibody.

I look forward to receiving your reply.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up