Overview

  • Product name

  • Description

    Rabbit polyclonal to NUDT5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human NUDT5 aa 34-166.
    Sequence:

    TTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQF RPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMD PGLSNCTIHIVTVTINGDDAENARPKPKPGDGE


    Database link: Q9UKK9

  • Positive control

    • IHC-P: Human liver and liver cancer tissues. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab238826 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF 1/200 - 1/500.

Target

  • Function

    Hydrolyzes with similar activities ADP-ribose, ADP-mannose, and ADP-glucose. Can also hydrolyze other nucleotide sugars with low activity.
  • Tissue specificity

    Widely expressed. Most abundant in liver.
  • Sequence similarities

    Belongs to the Nudix hydrolase family.
    Contains 1 nudix hydrolase domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • ADP sugar pyrophosphatase antibody
    • ADP-sugar pyrophosphatase antibody
    • hYSAH 1 antibody
    • hYSAH1 antibody
    • Nucleoside diphosphate linked moiety X motif 5 antibody
    • Nucleoside diphosphate linked moiety X type motif 5 antibody
    • Nucleoside diphosphate-linked moiety X motif 5 antibody
    • Nudix (nucleoside diphosphate linked moiety X) type motif 5 antibody
    • Nudix motif 5 antibody
    • Nudix type motif 5 antibody
    • NUDT 5 antibody
    • Nudt5 antibody
    • NUDT5_HUMAN antibody
    • YSA1 antibody
    • YSA1H antibody
    see all

Images

  • Paraffin-embedded human liver tissue stained for NUDT5 using ab238826 at 1/600 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • Paraffin-embedded human liver cancer tissue stained for NUDT5 using ab238826 at 1/600 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • 4% formaldehyde-fixed, 0.2% Triton X-100 permeabilized HepG2 (human liver hepatocellular carcinoma cell line) cells stained for NUDT5 (green) using ab238826 at 1/200 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L). Counter-stained with DAPI.

References

ab238826 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238826.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up