Anti-NUDT8 antibody (ab243729)
Key features and details
- Rabbit polyclonal to NUDT8
- Suitable for: IHC-P, WB, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-NUDT8 antibody -
Description
Rabbit polyclonal to NUDT8 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WB, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human NUDT8 aa 138-236.
Sequence:EVFALPLAHLLQTQNQGYTHFCRGGHFRYTLPVFLHGPHRVWGLTAVITE FALQLLAPGTYQPRLAGLTCSGAEGLARPKQPLASPCQASSTPGLNKGL
Database link: Q8WV74 -
Positive control
- IHC-P: Human colon tissue. WB: RT4 cell lysate. ICC/IF: U-251 MG cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab243729 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 25 kDa. | |
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Function
Probably mediates the hydrolysis of some nucleoside diphosphate derivatives. -
Sequence similarities
Belongs to the Nudix hydrolase family.
Contains 1 nudix hydrolase domain. -
Cellular localization
Mitochondrion. - Information by UniProt
-
Database links
- Entrez Gene: 254552 Human
- SwissProt: Q8WV74 Human
- Unigene: 433329 Human
-
Alternative names
- FLJ41567 antibody
- Nucleoside diphosphate linked moiety X motif 8 antibody
- Nucleoside diphosphate linked moiety X motif 8 mitochondrial antibody
see all
Images
-
PFA fixed, Triton X-100 permeabilized U-251 MG (Human brain glioma cell line) cells labeling NUDT8 using ab243729 at 4 µg/ml (green) in ICC/IF.
-
Anti-NUDT8 antibody (ab243729) at 0.4 µg/ml + RT4 (Human urinary bladder cancer cell line) cell lysate
Predicted band size: 25 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NUDT8 antibody (ab243729)
Formalin-fixed, paraffin-embedded human colon tissue stained for NUDT8 with ab243729 at a 1/20 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab243729 has not yet been referenced specifically in any publications.