Overview

  • Product name

  • Description

    Rabbit polyclonal to Nuf2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human Nuf2 aa 165-464.
    Sequence:

    KLERLDSVPVEEQEEFKQLSDGIQELQQSLNQDFHQKTIVLQEGNSQKKS NISEKTKRLNELKLSVVSLKEIQESLKTKIVDSPEKLKNYKEKMKDTVQK LKNARQEVVEKYEIYGDSVDCLPSCQLEVQLYQKKIQDLSDNREKLASIL KESLNLEDQIESDESELKKLKTEENSFKRLMIVKKEKLATAQFKINKKHE DVKQYKRTVIEDCNKVQEKRGAVYERVTTINQEIQKIKLGIQQLKDAAER EKLKSQEIFLNLKTALEKYHDGIEKAAEDSYAKIDEKTAELKRKMFKMST


    Database link: Q9BZD4

  • Positive control

    • WB: Mouse liver lysate; Jurkat, A431, PC-3, HEK-293T, HeLa and HepG2 whole cell lysate (ab7900). IHC-P: Human liver and skeletal muscle tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230313 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 54 kDa.

Target

  • Function

    Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity. Required for kinetochore integrity and the organization of stable microtubule binding sites in the outer plate of the kinetochore.
  • Sequence similarities

    Belongs to the NUF2 family.
  • Post-translational
    modifications

    Can be phosphorylated by AURKA and AURKB.
  • Cellular localization

    Nucleus. Chromosome > centromere > kinetochore. Localizes to kinetochores from late prophase to anaphase. Localizes specifically to the outer plate of the kinetochore.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cancer/testis antigen 106 antibody
    • CDCA 1 antibody
    • CDCA1 antibody
    • Cell division cycle associated 1 antibody
    • Cell division cycle associated protein 1 antibody
    • Cell division cycle-associated protein 1 antibody
    • CT106 antibody
    • hNuf 2 antibody
    • hNuf2 antibody
    • hNuf2R antibody
    • hsNuf2 antibody
    • Kinetochore protein Nuf2 antibody
    • Nuf 2 antibody
    • NUF2 antibody
    • NUF2 NDC80 kinetochore complex component antibody
    • NUF2 NDC80 kinetochore complex component homolog antibody
    • NUF2, S. cerevisiae, homolog of antibody
    • NUF2_HUMAN antibody
    • NUF2R antibody
    see all

Images

  • All lanes : Anti-Nuf2 antibody (ab230313) at 1/1000 dilution

    Lane 1 : Mouse liver lysate
    Lane 2 : Jurkat (Human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 3 : A431 (Human epidermoid carcinoma cell line) whole cell lysate
    Lane 4 : PC-3 (Human prostate adenocarcinoma cell line) whole cell lysate
    Lane 5 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 6 : HeLa (Human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 7 : HepG2 (Human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 54 kDa

  • Paraffin-embedded human liver tissue stained for Nuf2 using ab230313 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human skeletal muscle tissue stained for Nuf2 using ab230313 at 1/100 dilution in immunohistochemical analysis.

References

ab230313 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230313.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up