Overview

  • Product name

    Anti-NUFIP2 antibody
  • Description

    Rabbit polyclonal to NUFIP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human NUFIP2 aa 194-285.
    Sequence:

    NSGYITNGYMGKGADNDGSGSESGYTTPKKRKARRNSAKGCENLNIVQDK IMQQETSVPTLKQGLETFKPDYSEQKGNRVDGSKPIWKYETG


    Database link: Q7Z417

  • Positive control

    • ICC/IF: Caco-2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab221639 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

  • Function

    Binds RNA.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus. Cytoplasm. Distribution is cell cycle-modulated, being cytoplasmic in the G2/M phase and accumulating in nucleus during the G1 phase.
  • Information by UniProt
  • Database links

  • Alternative names

    • 82 kDa FMRP-interacting protein antibody
    • 82-FIP antibody
    • Cell proliferation-inducing gene 1 protein antibody
    • FMRP-interacting protein 2 antibody
    • Nuclear fragile X mental retardation-interacting protein 2 antibody
    • NUFIP2 antibody
    • NUFP2_HUMAN antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized Caco-2 (human colorectal adenocarcinoma cell line) cells stained for NUFIP2 (green) using ab221639 at 4 µg/ml in ICC/IF. 

References

ab221639 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221639.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up