Overview

  • Product name

  • Description

    Rabbit polyclonal to NUP133
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human NUP133 aa 899-1091. Expressed in E. coli. N-terminal tags.
    Sequence:

    DFLFRWYLEKGKRGKLLSQPISQHGQLANFLQAHEHLSWLHEINSQELEK AHATLLGLANMETRYFAKKKTLLGLSKLAALASDFSEDMLQEKIEEMAEQ ERFLLHQETLPEQLLAEKQLNLSAMPVLTAPQLIGLYICEENRRANEYDF KKALDLLEYIDEEEDININDLKLEILCKALQRDNWSSSDGKDD


    Database link: Q8WUM0

  • Positive control

    • WB: Recombinant human NUP133 protein; HeLa and HepG2 whole cell lysate. Human liver tissue lysate. IHC-P: Human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab233086 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 129 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Involved in poly(A)+ RNA transport.
  • Sequence similarities

    Belongs to the nucleoporin Nup133 family.
  • Cellular localization

    Nucleus > nuclear pore complex. Chromosome > centromere > kinetochore. Located on both the cytoplasmic and nuclear sides of the nuclear pore. During mitosis, localizes to the kinetochores.
  • Information by UniProt
  • Database links

  • Alternative names

    • 133 kDa nucleoporin antibody
    • FLJ10814 antibody
    • hNUP 133 antibody
    • hNUP133 antibody
    • MGC21133 antibody
    • NU133_HUMAN antibody
    • Nuclear pore complex protein Nup133 antibody
    • Nucleoporin 133kDa antibody
    • Nucleoporin NUP133 antibody
    • NUP 133 antibody
    • NUP133 antibody
    • OTTHUMP00000061095 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for NUP133 using ab233086 in at 20 μg/ml immunohistochemical analysis. DAB staining.

  • Anti-NUP133 antibody (ab233086) at 5 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml

    Predicted band size: 129 kDa

  • Anti-NUP133 antibody (ab233086) at 5 µg/ml + HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml

    Predicted band size: 129 kDa

  • Anti-NUP133 antibody (ab233086) at 5 µg/ml + Human liver tissue lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml

    Predicted band size: 129 kDa

  • Anti-NUP133 antibody (ab233086) at 2 µg/ml + Recombinant human NUP133 protein

    Predicted band size: 129 kDa

References

ab233086 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233086.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up