Overview

  • Product name
  • Description
    Mouse polyclonal to NUP35
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Full length protein corresponding to Human NUP35 aa 1-326.
    Sequence:

    MAAFAVEPQGPALGSEPMMLGSPTSPKPGVNAQFLPGFLMGDLPAPVTPQ PRSISGPSVGVMEMRSPLLAGGSPPQPVVPAHKDKSGAPPVRSIYDDISS PGLGSTPLTSRRQPNISVMQSPLVGVTSTPGTGQSMFSPASIGQPRKTTL SPAQLDPFYTQGDSLTSEDHLDDSWVTVFGFPQASASYILLQFAQYGNIL KHVMSNTGNWMHIRYQSKLQARKALSKDGRIFGESIMIGVKPCIDKSVME SSDRCALSSPSLAFTPPIKTLGTPTQPGSTPRISTMRPLATAYKASTSDY QVISDRQTPKKDESLVSKAMEYMFGW


    Database link: NP_612142.2

  • Positive control
    • NUP35 transfected 293T cell lysate.
  • General notes

    Previously labelled as Nup53.

Properties

Applications

Our Abpromise guarantee covers the use of ab169162 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 35 kDa.

Target

  • Function
    Functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs). Can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors. May play a role in the association of MAD1 with the NPC.
  • Sequence similarities
    Belongs to the Nup53 family.
    Contains 1 RRM Nup35-type domain.
  • Cellular localization
    Nucleus > nuclear pore complex. Nucleus membrane. Tightly associated with the nuclear membrane and lamina.
  • Information by UniProt
  • Database links
  • Alternative names
    • 35 kDa nucleoporin antibody
    • Mitotic phosphoprotein 44 antibody
    • MP 44 antibody
    • MP-44 antibody
    • NP 44 antibody
    • NP44 antibody
    • Nuclear pore complex protein 53kDa antibody
    • Nuclear pore complex protein Nup 53 antibody
    • Nuclear pore complex protein Nup53 antibody
    • Nuclear pore protein NUP 53 antibody
    • Nuclear pore protein NUP53 antibody
    • Nucleoporin 35kDa antibody
    • Nucleoporin 53kDa antibody
    • Nucleoporin Nup 35 antibody
    • Nucleoporin NUP 53 antibody
    • Nucleoporin Nup35 antibody
    • Nucleoporin NUP53 antibody
    • NUP 35 antibody
    • Nup 53 antibody
    • NUP35 antibody
    • NUP53 antibody
    • NUP53_HUMAN antibody
    see all

Images

  • All lanes : Anti-NUP35 antibody (ab169162) at 1 µg/ml

    Lane 1 : NUP35 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Developed using the ECL technique.

    Predicted band size: 35 kDa

References

ab169162 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169162.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up