Overview

  • Product name

  • Description

    Rabbit polyclonal to NUP88
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse NUP88 aa 57-296. Expressed in E.Coli. N-terminal tags.
    Sequence:

    MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFLPTRNLVFGLGGEL FLWDAEGSAFLVVRLRGPSGGGVEPPLSQYQRLLCINPPLFEIHQVLLSP TQHHVALIGSKGLMALELPQRWGKDSEFEGGKATVNCSTIPIAERFFTSS TSLTLKHAAWYPSEMLDPHIVLLTSDNVIRIYSLREPQTPTKVIVLSEAE EESLILNKGRAYTASLGETAVAFDFGPLVTVSKNIFEQKDRDVVAYPLYI LYENGETFLTYVSLLHSPGNIGKLLG


    Database link: Q5QNU0

  • Positive control

    • WB: Recombinant mouse NUP88 protein; mouse liver lysate; HeLa and HepG2 cell lysates. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab231187 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 84 kDa.
ICC/IF Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Essential component of nuclear pore complex.
  • Tissue specificity

    Ubiquitous.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus > nuclear pore complex.
  • Information by UniProt
  • Database links

  • Alternative names

    • 88 kDa nucleoporin antibody
    • karyoporin antibody
    • Nuclear pore complex protein 88 antibody
    • Nuclear pore complex protein Nup88 antibody
    • Nuclear pore complex protein88 antibody
    • Nucleoporin 88 antibody
    • Nucleoporin 88 kDa antibody
    • Nucleoporin 88kDa antibody
    • Nucleoporin Nup88 antibody
    • Nucleoporin88 antibody
    • Nucleoporin88kDa antibody
    • Nup 84 antibody
    • NUP 88 antibody
    • Nup84 antibody
    • NUP88 antibody
    • NUP88_HUMAN antibody
    • Prei 2 antibody
    • Prei2 antibody
    • Preimplantation protein 2 antibody
    • Preimplantation protein2 antibody
    see all

Images

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for NUP88 (green) using ab231187 at 20 μg/ml in ICC/IF. FITC labeled secondary antibody.

  • All lanes : Anti-NUP88 antibody (ab231187) at 2 µg/ml

    Lane 1 : Mouse liver lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 3 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 84 kDa

  • Anti-NUP88 antibody (ab231187) at 2 µg/ml + Recombinant mouse NUP88 protein

    Predicted band size: 84 kDa

References

ab231187 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231187.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up