Overview

  • Product name

  • Description

    Rabbit polyclonal to NUR77
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human NUR77 aa 375-425 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    SGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKI P


    Database link: P22736

  • Positive control

    • Rat brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab217547 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function

    Orphan nuclear receptor. May act concomitantly with NURR1 in regulating the expression of delayed-early genes during liver regeneration. Binds the NGFI-B response element (NBRE) 5'-AAAAGGTCA-3' (By similarity). May inhibit NF-kappa-B transactivation of IL2.
  • Tissue specificity

    Fetal muscle and adult liver, brain and thyroid.
  • Sequence similarities

    Belongs to the nuclear hormone receptor family. NR4 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Early response protein NAK1 antibody
    • GFRP 1 antibody
    • GFRP antibody
    • GFRP1 antibody
    • Growth factor inducible nuclear protein N10 antibody
    • Growth Factor Inducible Nuclear Protein NP10 antibody
    • Growth Factor Response Protein 1 antibody
    • Hbr1 antibody
    • HMR antibody
    • Hormone Receptor antibody
    • MGC9485 antibody
    • N10 antibody
    • N10 nuclear protein antibody
    • NAK 1 antibody
    • NAK1 antibody
    • Nerve growth factor IB nuclear receptor variant 1 antibody
    • NGFIB antibody
    • NP 10 antibody
    • NP10 antibody
    • NR4A1 antibody
    • NR4A1_HUMAN antibody
    • Nuclear hormone receptor NUR/77 antibody
    • Nuclear Hormone Receptor TR3 antibody
    • Nuclear receptor subfamily 4 group A member 1 antibody
    • NUR77 antibody
    • NUR77, mouse, homolog of antibody
    • Orphan nuclear receptor HMR antibody
    • Orphan nuclear receptor NR4A1 antibody
    • Orphan nuclear receptor TR3 antibody
    • Orphan receptor tr3 antibody
    • Receptor NGFIB antibody
    • ST 59 antibody
    • ST-59 antibody
    • ST59 antibody
    • Steroid receptor TR3 antibody
    • Testicular receptor 3 antibody
    • TR 3 antibody
    • TR3 antibody
    • TR3 orphan receptor antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling NUR77 with ab217547 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab217547 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217547.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up