Overview

  • Product name
  • Description
    Mouse polyclonal to NUSAP
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human NUSAP aa 216-441.
    Sequence:

    MNELKQQPINKGGVRTPVPPRGRLSVASTPISQRRSQGRSCGPASQSTLG LKGSLKRSAISAAKTGVRFSAATKDNEHKRSLTKTPARKSAHVTVSGGTP KGEAVLGTHKLKTITGNSAAVITPFKLTTEATQTPVSNKKPVFDLKASLS RPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQTKEEQR KKREQERKEKKAKVLGMRRGLILAED


    Database link: NP_057443

  • Positive control
    • HeLa cells. NuSAP-transfected 293T cell lysate.
  • General notes

    Previously labelled as NUSAP1.

Properties

Applications

Our Abpromise guarantee covers the use of ab169083 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 49 kDa.
ICC/IF Use a concentration of 10 µg/ml.

Target

  • Function
    Microtubule-associated protein with the capacity to bundle and stabilize microtubules (By similarity). May associate with chromosomes and promote the organization of mitotic spindle microtubules around them.
  • Sequence similarities
    Belongs to the NUSAP family.
  • Domain
    The KEN box is required for the FZR1-dependent degradation of this protein subsequent to ubiquitination.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
    Ubiquitinated. Ubiquitination by FZR1 may lead to proteasome-dependent degradation of this protein.
  • Cellular localization
    Cytoplasm. Nucleus > nucleolus. Cytoplasm > cytoskeleton > spindle. Chromosome. Found in the cytoplasm and nucleolus during interphase and redistributes to the mitotic spindle in prometaphase (By similarity). Localizes to the mitotic spindle during anaphase and telophase then disappears from around the chromosomes during cytokinesis (By similarity). Localizes to multiple distinct regions of chromosomes throughout mitosis.
  • Information by UniProt
  • Database links
  • Alternative names
    • 2610201A12Rik antibody
    • AI481307 antibody
    • ANKT antibody
    • AW547774 antibody
    • BB165529 antibody
    • BM037 antibody
    • FLJ13421 antibody
    • LNP antibody
    • Nucleolar and spindle associated protein 1 antibody
    • Nucleolar and spindle-associated protein 1 antibody
    • Nucleolar protein ANKT antibody
    • NuSAP antibody
    • NUSAP_HUMAN antibody
    • nusap1 antibody
    • PRO0310p1 antibody
    • Q0310 antibody
    • RP23-22A15.4 antibody
    • SAPL antibody
    see all

Images

  • All lanes : Anti-NUSAP antibody (ab169083) at 1 µg/ml

    Lane 1 : NUSAP1-transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution

    Developed using the ECL technique.

    Predicted band size: 49 kDa

  • Immunofluorescent analysis of HeLa cells labeling NuSAP with ab169083 at 10µg/ml.

References

ab169083 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169083.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up