Anti-NUSAP antibody (ab169083)
Key features and details
- Mouse polyclonal to NUSAP
- Suitable for: WB, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-NUSAP antibody
See all NUSAP primary antibodies -
Description
Mouse polyclonal to NUSAP -
Host species
Mouse -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human NUSAP aa 216-441.
Sequence:MNELKQQPINKGGVRTPVPPRGRLSVASTPISQRRSQGRSCGPASQSTLG LKGSLKRSAISAAKTGVRFSAATKDNEHKRSLTKTPARKSAHVTVSGGTP KGEAVLGTHKLKTITGNSAAVITPFKLTTEATQTPVSNKKPVFDLKASLS RPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQTKEEQR KKREQERKEKKAKVLGMRRGLILAED
Database link: NP_057443 -
Positive control
- HeLa cells. NuSAP-transfected 293T cell lysate.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. -
Storage buffer
pH: 7.4
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab169083 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
Use a concentration of 1 µg/ml. Predicted molecular weight: 49 kDa.
|
|
ICC/IF |
Use a concentration of 10 µg/ml.
|
Notes |
---|
WB
Use a concentration of 1 µg/ml. Predicted molecular weight: 49 kDa. |
ICC/IF
Use a concentration of 10 µg/ml. |
Target
-
Function
Microtubule-associated protein with the capacity to bundle and stabilize microtubules (By similarity). May associate with chromosomes and promote the organization of mitotic spindle microtubules around them. -
Sequence similarities
Belongs to the NUSAP family. -
Domain
The KEN box is required for the FZR1-dependent degradation of this protein subsequent to ubiquitination. -
Post-translational
modificationsPhosphorylated upon DNA damage, probably by ATM or ATR.
Ubiquitinated. Ubiquitination by FZR1 may lead to proteasome-dependent degradation of this protein. -
Cellular localization
Cytoplasm. Nucleus > nucleolus. Cytoplasm > cytoskeleton > spindle. Chromosome. Found in the cytoplasm and nucleolus during interphase and redistributes to the mitotic spindle in prometaphase (By similarity). Localizes to the mitotic spindle during anaphase and telophase then disappears from around the chromosomes during cytokinesis (By similarity). Localizes to multiple distinct regions of chromosomes throughout mitosis. - Information by UniProt
-
Database links
- Entrez Gene: 51203 Human
- Omim: 612818 Human
- SwissProt: Q9BXS6 Human
- Unigene: 615092 Human
-
Alternative names
- 2610201A12Rik antibody
- AI481307 antibody
- ANKT antibody
see all
Images
-
All lanes : Anti-NUSAP antibody (ab169083) at 1 µg/ml
Lane 1 : NUSAP1-transfected 293T cell lysate
Lane 2 : Non-transfected 293T cell lysate
Lysates/proteins at 15 µl per lane.
Secondary
All lanes : Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution
Developed using the ECL technique.
Predicted band size: 49 kDa -
Immunofluorescent analysis of HeLa cells labeling NuSAP with ab169083 at 10µg/ml.
Protocols
Datasheets and documents
-
Datasheet download
References (3)
ab169083 has been referenced in 3 publications.
- Zhang L et al. Hypoxia stimulates the migration and invasion of osteosarcoma via up-regulating the NUSAP1 expression. Open Med (Wars) 16:1083-1089 (2021). PubMed: 34322597
- Hao L et al. Knockdown of P3H4 inhibits proliferation and invasion of bladder cancer. Aging (Albany NY) 12:2156-2168 (2020). PubMed: 32018225
- Zhang J & Fan J Prazosin inhibits the proliferation, migration and invasion, but promotes the apoptosis of U251 and U87 cells via the PI3K/AKT/mTOR signaling pathway. Exp Ther Med 20:1145-1152 (2020). PubMed: 32765662