Overview

  • Product name

  • Description

    Rabbit polyclonal to NXN/NRX
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat
    Predicted to work with: Cow, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse NXN/NRX aa 167-435. (Expressed in E.coli).
    Sequence:

    PKPFREVIAGPLLRNNGQSLESSSLEGSHVGVYFSAHWCPPCRSLTRVLV ESYRKIKEAGQEFEIIFVSADRSEESFKQYFSEMPWLAVPYTDEARRSRL NRLYGIQGIPTLIVLDPQGEVITRQGRVEVLNDEDCREFPWHPKPVLELS DSNAVQLNEGPCLVLFVDSEDDGESEAAKQLIQPIAEKIIAKYKAKEEEA PLLFFVAGEDDMTDSLRDYTNLPEAAPLLTILDMSARAKYVMDVEEITPA IVETFVNDFLAEKLKPEPI


    Database link: P97346

  • Positive control

    • IHC-P: Mouse liver, testis, ovary and kidney tissues. WB: Mouse brain and testis lysates; Rat testis lysate; Recombinant mouse NXN/NRX protein.
  • General notes

     This product was previously labelled as NXN

     

Properties

Applications

Our Abpromise guarantee covers the use of ab233183 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 48 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Paraffin-embedded mouse liver tissue stained for NXN/NRX using ab233183 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse testis tissue stained for NXN/NRX using ab233183 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse ovary tissue stained for NXN/NRX using ab233183 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse kidney tissue stained for NXN/NRX using ab233183 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-NXN/NRX antibody (ab233183) at 1 µg/ml + Recombinant mouse NXN/NRX protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 48 kDa

  • All lanes : Anti-NXN/NRX antibody (ab233183) at 1 µg/ml

    Lane 1 : Mouse brain lysate
    Lane 2 : Mouse testis lysate
    Lane 3 : Rat brain lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 48 kDa

References

ab233183 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233183.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up