Overview

  • Product name

  • Description

    Rabbit polyclonal to NXN/NRX
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human NXN/NRX aa 166-327. (Expressed in E.coli).
    Sequence:

    GPKPFREVIAGPLLRNNGQSLESSSLEGSHVGVYFSAHWCPPCRSLTRVL VESYRKIKEAGQNFEIIFVSADRSEESFKQYFSEMPWLAVPYTDEARRSR LNRLYGIQGIPTLIMLDPQGEVITRQGRVEVLNDEDCREFPWHPKPVLEL SDSNAAQLNEGP


    Database link: Q6DKJ4

  • Positive control

    • IHC-P: Human cerebrum and liver tissues. WB: Recombinant human NXN/NRX protein; Mouse testis lysate.
  • General notes

     This product was previously labelled as NXN

     

Properties

Applications

Our Abpromise guarantee covers the use of ab233241 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 48 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Anti-NXN/NRX antibody (ab233241) at 2 µg/ml + Mouse testis lysate

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 48 kDa

  • Anti-NXN/NRX antibody (ab233241) at 2 µg/ml + Recombinant human NXN/NRX protein

    Secondary
    HRP-Linked Guineapig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 48 kDa

  • Paraffin-embedded human liver tissue stained for NXN/NRX using ab233241 at 20 µg/m in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human cerebrum tissue stained for NXN/NRX using ab233241 at 20 µg/ml in immunohistochemical analysis. DAB staining.

References

ab233241 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233241.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up