Overview

  • Product name

  • Description

    Rabbit polyclonal to OATP1A2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to Human OATP1A2 aa 451-500 (internal sequence).
    Sequence:

    VCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQTSGNSSAVLGLCDK


    Database link: AAD52694

  • General notes

    Previously labelled as SLCO1A2.

Properties

Applications

Our Abpromise guarantee covers the use of ab105124 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 74 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Mediates the Na(+)-independent transport of organic anions such as sulfobromophthalein (BSP) and conjugated (taurocholate) and unconjugated (cholate) bile acids (By similarity). Selectively inhibited by the grapefruit juice component naringin.
  • Sequence similarities

    Belongs to the organo anion transporter (TC 2.A.60) family.
    Contains 1 Kazal-like domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • OATP antibody
    • OATP-1 antibody
    • OATP-A antibody
    • OATP1A2 antibody
    • Organic anion-transporting polypeptide 1 antibody
    • SLC21A3 antibody
    • SLCO1A2 antibody
    • SO1A2_HUMAN antibody
    • Sodium-independent organic anion transporter antibody
    • Solute carrier family 21 member 3 antibody
    • Solute carrier organic anion transporter family member 1A2 antibody
    see all

Images

  • Anti-OATP1A2 antibody (ab105124) (0.2-1 µg/ml) + Human PANC1 cell lysate

    Predicted band size: 74 kDa

References

ab105124 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Question
Answer

Thank you for contacting us. Many thanks for having patience!

The amino acid range of immunogen for ab110392 is aa250-300 of human solute carrier organic anion transporter family member 1A2 with accession number P46721(http://www.uniprot.org/uniprot/P46721). This antibody binds to the cytoplasmic topological domain (based on prediction) of isoforms OATP1a and OATP1b.

So I can confirm that the major difference in these antibodies is the immunogen they binds to.

Please select the product as per your requirements.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up