Overview

  • Product name

  • Description

    Rabbit polyclonal to OATP1A2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human OATP1A2 aa 265-315.
    Sequence:

    FLPNTLPKEGLETNADIIKNENEDKQKEEVKKEKYGITKDFLPFMKSLSC N


    Database link: P46721

  • Positive control

    • ICC/IF: SH-SY5Y cells. WB: RT4 and U-251 MG cell lysates.
  • General notes

    Previously labelled as SLCO1A2.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab221804 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/100 - 1/250. Predicted molecular weight: 74 kDa.

Target

  • Function

    Mediates the Na(+)-independent transport of organic anions such as sulfobromophthalein (BSP) and conjugated (taurocholate) and unconjugated (cholate) bile acids (By similarity). Selectively inhibited by the grapefruit juice component naringin.
  • Sequence similarities

    Belongs to the organo anion transporter (TC 2.A.60) family.
    Contains 1 Kazal-like domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • OATP antibody
    • OATP-1 antibody
    • OATP-A antibody
    • OATP1A2 antibody
    • Organic anion-transporting polypeptide 1 antibody
    • SLC21A3 antibody
    • SLCO1A2 antibody
    • SO1A2_HUMAN antibody
    • Sodium-independent organic anion transporter antibody
    • Solute carrier family 21 member 3 antibody
    • Solute carrier organic anion transporter family member 1A2 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized SH-SY5Y (human neuroblastoma cell line from bone marrow) cells stained for OATP1A2 (green) using ab221804 at 4 µg/ml in ICC/IF.

  • All lanes : Anti-OATP1A2 antibody (ab221804) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (human brain glioma cell line) cell lysate

    Predicted band size: 74 kDa

References

ab221804 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221804.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up