Overview

  • Product name

  • Description

    Rabbit polyclonal to OATP1B1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human OATP1B1 aa 426-537.
    Sequence:

    FFILCENKSVAGLTMTYDGNNPVTSHRDVPLSYCNSDCNCDESQWEPVCG NNGITYISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECP RDDACTRKFYFF


    Database link: Q9Y6L6

  • Positive control

    • WB: Rat brain and heart tissue lysate. Mouse brain and stomach tissue lysate. IHC-P: Human liver cancer tissue.
  • General notes

     This product was previously labelled as OATP2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab224610 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.
IHC-P 1/20 - 1/200.

Target

  • Function

    Mediates the Na(+)-independent uptake of organic anions such as pravastatin, taurocholate, methotrexate, dehydroepiandrosterone sulfate, 17-beta-glucuronosyl estradiol, estrone sulfate, prostaglandin E2, thromboxane B2, leukotriene C3, leukotriene E4, thyroxine and triiodothyronine. May play an important role in the clearance of bile acids and organic anions from the liver.
  • Tissue specificity

    Highly expressed in liver. Not detected in heart, brain, placenta, lung, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine, colon and leukocyte.
  • Sequence similarities

    Belongs to the organo anion transporter (TC 2.A.60) family.
    Contains 1 Kazal-like domain.
  • Cellular localization

    Basolateral cell membrane. Detected in basolateral membranes of hepatocytes.
  • Information by UniProt
  • Database links

  • Alternative names

    • Liver-specific organic anion transporter 1 antibody
    • LST-1 antibody
    • LST1 antibody
    • OATP-2 antibody
    • OATP-C antibody
    • OATP1B1 antibody
    • OATPC antibody
    • SLC21A6 antibody
    • SLCO1B1 antibody
    • SO1B1_HUMAN antibody
    • Sodium-independent organic anion-transporting polypeptide 2 antibody
    • Solute carrier family 21 member 6 antibody
    • Solute carrier organic anion transporter family member 1B1 antibody
    see all

Images

  • All lanes : Anti-OATP1B1 antibody (ab224610) at 1/500 dilution

    Lane 1 : Rat brain tissue lysate
    Lane 2 : Rat heart tissue lysate
    Lane 3 : Mouse brain tissue lysate
    Lane 4 : Mouse stomach tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
  • Paraffin embedded human liver cancer tissue stained for OATP1B1 with ab224610 (1/100 dilution) in immunohistochemical analysis.

References

ab224610 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224610.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up