Overview

  • Product name

  • Description

    Rabbit polyclonal to OAZ1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human OAZ1 aa 119-228.
    Sequence:

    QSRLTDAKRINWRTVLSGGSLYIEIPGGALPEGSKDSFAVLLEFAEEQLR ADHVFICFHKNREDRAALLRTFSFLGFEIVRPGHPLVPKRPDACFMAYTF ERESSGEEEE


    Database link: P54368

  • Positive control

    • IHC-P: Human skeletal muscle tissue. ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224080 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

IHC-P 1/20 - 1/50.

Target

  • Function

    Binds to, and destabilizes, ornithine decarboxylase which is then degraded. Also inhibits cellular uptake of polyamines by inactivating the polyamine uptake transporter. SMAD1/OAZ1/PSMB4 complex mediates the degradation of the CREBBP/EP300 repressor SNIP1.
  • Sequence similarities

    Belongs to the ODC antizyme family.
  • Information by UniProt
  • Database links

  • Alternative names

    • Antizyme 1 antibody
    • Antizyme antibody
    • AZI antibody
    • MGC138338 antibody
    • OAZ 1 antibody
    • OAZ antibody
    • OAZ1 antibody
    • OAZ1_HUMAN antibody
    • ODC Az antibody
    • ODC-Az antibody
    • Ornithine decarboxylase antizyme 1 antibody
    • Ornithine decarboxylase antizyme antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for OAZ1 (green) using ab224080 (4 µg/ml) in ICC/IF.

  • Paraffin embedded human skeletal muscle tissue stained for OAZ1 with ab224080 (1/20 dilution) in immunohistochemical analysis.

References

ab224080 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224080.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up