Overview

  • Product name

  • Description

    Rabbit polyclonal to OB Cadherin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Chicken
  • Immunogen

    Recombinant fragment corresponding to Human OB Cadherin aa 637-796.
    Sequence:

    FVTLRRQKKEPLIVFEEEDVRENIITYDDEGGGEEDTEAFDIATLQNPDG INGFIPRKDIKPEYQYMPRPGLRPAPNSVDVDDFINTRIQEADNDPTAPP YDSIQIYGYEGRGSVAGSLSSLESATTDSDLDYDYLQNWGPRFKKLADLY GSKDTFDDDS


    Database link: P55287

  • Positive control

    • IHC: Human lung cancer tissue. ICC/IF: PC-3 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab223087 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.
  • Tissue specificity

    Expressed mainly in brain but also found in other tissues. Expressed in neuroblasts.
  • Involvement in disease

    Note=A chromosomal aberration involving CDH11 is a common genetic feature of aneurysmal bone cyst, a benign osseous neoplasm. Translocation t(16;17)(q22;p13) with USP6. The translocation generates a fusion gene in which the strong CDH11 promoter is fused to the entire USP6 coding sequence, resulting in USP6 transcriptional up-regulation.
  • Sequence similarities

    Contains 5 cadherin domains.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CAD11 antibody
    • CAD11_HUMAN antibody
    • Cadherin 11 antibody
    • Cadherin 11 type 2 antibody
    • Cadherin 11 type 2 OB cadherin (osteoblast) antibody
    • Cadherin-11 antibody
    • Cdh11 antibody
    • CDHOB antibody
    • OB antibody
    • OB-cadherin antibody
    • OBcadherin antibody
    • OSF-4 antibody
    • OSF4 antibody
    • Osteoblast cadherin antibody
    see all

Images

  • Paraffin-embedded human lung cancer tissue tissue stained for OB Cadherin using ab223087 at 1/100 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized PC-3 (human prostate adenocarcinoma cell line) cells stained for OB Cadherin (green) using ab223087 at 1/100 dilution in ICC/IF. Secondary: Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab223087 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223087.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up