Overview

  • Product name

    Anti-OBFC2A antibody [OTI6B10]
    See all OBFC2A primary antibodies
  • Description

    Mouse monoclonal [OTI6B10] to OBFC2A
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human OBFC2A aa 1-204. Produced in E.coli (NP_001026886).
    Sequence:

    MNRVNDPLIFIRDIKPGLKNLNVVFIVLEIGRVTKTKDGHEVRSCKVADK TGSITISVWDEIGGLIQPGDIIRLTRGYASMWKGCLTLYTGRGGELQKIG EFCMVYSEVPNFSEPNPDYRGQQNKGAQSEQKNNSMNSNMGTGTFGPVGN GVHTGPESREHQFSHAGRSNGRGLINPQLQGTASNQTVMTTISNGRDPRR AFKR


    Database link: Q96AH0

  • Positive control

    • WB: HEK-293T cell lysate transfected with pCMV6-ENTRY OBFC2A cDNA for 48 hrs; HeLa cell lysate. IHC-P: Human breast, colon adenocarcinoma, kidney, thyroid, endometrium, prostate and bladder carcinoma tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant by affinity chromatography.
  • Clonality

    Monoclonal
  • Clone number

    OTI6B10
  • Isotype

    IgG2b
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236402 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500.

Perform heat mediated antigen retrieval with Tris/EDTA buffer pH 8.5 before commencing with IHC staining protocol.

WB 1/500 - 1/2000. Predicted molecular weight: 22 kDa.

Target

  • Function

    Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. In the SOSS complex, acts as a sensor of single-stranded DNA that binds to single-stranded DNA, in particular to polypyrimidines. The SOSS complex associates with DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) and ATM-dependent signaling pathways.
  • Sequence similarities

    Belongs to the SOSS-B family. SOSS-B2 subfamily.
    Contains 1 OB DNA-binding domain.
  • Cellular localization

    Nucleus. Localizes to nuclear foci following DNA damage.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ13624 antibody
    • FLJ22833 antibody
    • hSSB2 antibody
    • MGC111163 antibody
    • Nabp1 antibody
    • Nucleic acid-binding protein 1 antibody
    • OBFC2A antibody
    • Oligonucleotide/oligosaccharide binding fold containing 2A antibody
    • Oligonucleotide/oligosaccharide binding fold containing protein 2A antibody
    • Oligonucleotide/oligosaccharide-binding fold-containing protein 2A antibody
    • Sensor of single strand DNA complex subunit B2 antibody
    • Sensor of single-strand DNA complex subunit B2 antibody
    • Sensor of ssDNA subunit B2 antibody
    • Single stranded DNA binding protein 2 antibody
    • Single-stranded DNA-binding protein 2 antibody
    • SOSB2_HUMAN antibody
    • SOSS B2 antibody
    • SOSS complex subunit B2 antibody
    • SOSS-B2 antibody
    • SSB2 antibody
    see all

Images

  • All lanes : Anti-OBFC2A antibody [OTI6B10] (ab236402) at 1/2000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control cDNA for 48 hrs
    Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY OBFC2A cDNA for 48 hrs

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 22 kDa

  • Anti-OBFC2A antibody [OTI6B10] (ab236402) at 1/500 dilution + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate at 35 µg

    Predicted band size: 22 kDa

  • Paraffin-embedded human breast tissue stained for OBFC2A using ab236402 at 1/500 dilution in immunohistochemical analysis.

  • Paraffin-embedded human colon adenocarcinoma tissue stained for OBFC2A using ab236402 at 1/500 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for OBFC2A using ab236402 at 1/500 dilution in immunohistochemical analysis.

  • Paraffin-embedded human thyroid tissue stained for OBFC2A using ab236402 at 1/500 dilution in immunohistochemical analysis.

  • Paraffin-embedded human endometrium tissue stained for OBFC2A using ab236402 at 1/500 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate tissue stained for OBFC2A using ab236402 at 1/500 dilution in immunohistochemical analysis.

  • Paraffin-embedded human bladder carcinoma tissue stained for OBFC2A using ab236402 at 1/500 dilution in immunohistochemical analysis.

References

ab236402 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236402.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up