Overview

  • Product name

    Anti-OBPIIa antibody
  • Description

    Rabbit polyclonal to OBPIIa
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide corresponding to Human OBPIIa aa 61-110 (internal sequence).
    Sequence:

    NLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDY


    Database link: NP_055397

  • Positive control

    • Human fetal stomach lysate
  • General notes

    Previously labelled as OBP2A.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab130911 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 19 kDa.

Target

  • Function

    Probably binds and transports small hydrophobic volatile molecules with a higher affinity for aldehydes and large fatty acids.
  • Tissue specificity

    Strongly expressed in the nasal structures, salivary and lachrymal glands, and lung.
  • Sequence similarities

    Belongs to the calycin superfamily. Lipocalin family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • hOBPIIa antibody
    • OBP antibody
    • OBP2A antibody
    • OBP2A_HUMAN antibody
    • OBP2C antibody
    • OBPIIa antibody
    • Odorant-binding protein 2a antibody
    • Odorant-binding protein IIa antibody
    • Putative odorant binding protein 2c antibody
    see all

Images

  • Anti-OBPIIa antibody (ab130911) at 1 µg/ml + Human fetal stomach lysate at 10 µg

    Predicted band size: 19 kDa



    Gel concentration: 10-20%

References

ab130911 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab130911.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up