Overview

  • Product name

  • Description

    Rabbit polyclonal to OBSL1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human OBSL1 aa 1267-1355.
    Sequence:

    VRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQ LEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVE


    Database link: O75147

  • Positive control

    • Human kidney tissue; U-251 MG cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab204075 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Tissue specificity

    Widely expressed, with predominant levels found in the heart.
  • Involvement in disease

    Defects in OBSL1 are the cause of 3M syndrome type 2 (3M2) [MIM:612921]. An autosomal recessive disorder characterized by severe pre- and postnatal growth retardation, facial dysmorphism, large head circumference, and normal intelligence and endocrine function. Skeletal changes include long slender tubular bones and tall vertebral bodies.
  • Sequence similarities

    Contains 1 fibronectin type-III domain.
    Contains 11 Ig-like (immunoglobulin-like) domains.
  • Information by UniProt
  • Database links

  • Alternative names

    • KIAA0657 antibody
    • Obscurin-like protein 1 antibody
    • OBSL1 antibody
    • OBSL1_HUMAN antibody

Images

  • Immunofluorescence analysis of U-251 MG cells (PFA-fixed/Triton X-100 permeabilized) labeling OBSL1 with ab204075 at 4 µg/ml.

  • Immunohistochemical analysis of paraffin-embedded Human kidney tissue, labeling OBSL1 with ab204075 at 1/50 dilution.

References

ab204075 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204075.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up