Overview

  • Product name

    Anti-OCC1 antibody - N-terminal
    See all OCC1 primary antibodies
  • Description

    Rabbit polyclonal to OCC1 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Cow, Pig
  • Immunogen

    Synthetic peptide within Human OCC1 aa 15-63 (N terminal). The exact sequence is proprietary. (NP_001138671).
    Sequence:

    QGPAGAAKDVTEESVTEDDKRRNYGGVYVGLPSEAVNMVSSQTKTVRKN


    Database link: Q8TAD7

  • Positive control

    • NCI-H226 whole cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab177759 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 6 kDa.

Target

  • Tissue specificity

    High expression in placenta, skeletal muscle, kidney and pancreas tissues. Absent or very faint expression in heart, brain, lung and liver. Expressed during adipogenic differentiation of mesenchymal stem cells (at protein level).
  • Sequence similarities

    Belongs to the OCC1 family.
  • Information by UniProt
  • Database links

  • Alternative names

    • Adipogenesis down regulated 3 antibody
    • AGD3 antibody
    • C12orf75 antibody
    • Chromosome 12 open reading frame 75 antibody
    • Hypothetical protein LOC387882 antibody
    • MGC148100 antibody
    • MGC149157 antibody
    • OCC 1 antibody
    • OCC-1 antibody
    • OCC1 antibody
    • OCC1_HUMAN antibody
    • Overexpressed in colon carcinoma 1 antibody
    • Overexpressed in colon carcinoma 1 protein antibody
    • Putative overexpressed in colon carcinoma 1 protein antibody
    see all

Images

  • Anti-OCC1 antibody - N-terminal (ab177759) at 1 µg/ml + NCI-H226 whole cell lysate at 10 µg

    Predicted band size: 6 kDa

References

This product has been referenced in:

  • Lan Y  et al. Long noncoding RNA OCC-1 suppresses cell growth through destabilizing HuR protein in colorectal cancer. Nucleic Acids Res 46:5809-5821 (2018). Read more (PubMed: 29931370) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177759.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up