Overview

  • Product name
  • Description
    Rabbit polyclonal to Occludin
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rat, Dog, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human Occludin aa 1-522.
    Sequence:

    MSSRPLESPPPYRPDEFKPNHYAPSNDIYGGEMHVRPMLSQPAYSFYPED EILHFYKWTSPPGVIRILSMLIIVMCIAIFACVASTLAWDRGYGTSLLGG SVGYPYGGSGFGSYGSGYGYGYGYGYGYGGYTDPRAAKGFMLAMAAFCFI AALVIFVTSVIRSEMSRTRRYYLSVIIVSAILGIMVFIATIVYIMGVNPT AQSSGSLYGSQIYALCNQFYTPAATGLYVDQYLYHYCVVDPQEAIAIVLG FMIIVAFALIIFFAVKTRRKMDRYDKSNILWDKEHIYDEQPPNVEEWVKN VSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEV VQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYET DYTTGGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSEL DEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHC KQLKSKLSHIKKMVGDYDRQKT


    Database link: NP_002529.1

  • Positive control
    • Human and Mouse liver lysates; Occludin-transfected 293T cell line lysate This antibody gave a positive result in IHC in the following FFPE tissue: Human normal kidney

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Constituent: 100% PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab168986 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 59 kDa.
IHC-P Use a concentration of 5 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    May play a role in the formation and regulation of the tight junction (TJ) paracellular permeability barrier. It is able to induce adhesion when expressed in cells lacking tight junctions.
  • Tissue specificity
    Localized at tight junctions of both epithelial and endothelial cells. Highly expressed in kidney. Not detected in testis.
  • Involvement in disease
    Defects in OCLN are the cause of band-like calcification with simplified gyration and polymicrogyria (BLCPMG) [MIM:251290]; also known as pseudo-TORCH syndrome. BLCPMG is a neurologic disorder with characteristic clinical and neuroradiologic features that mimic intrauterine TORCH infection in the absence of evidence of infection. Affected individuals have congenital microcephaly, intracranial calcifications, and severe developmental delay.
  • Sequence similarities
    Belongs to the ELL/occludin family.
    Contains 1 MARVEL domain.
  • Domain
    The C-terminal is cytoplasmic and is important for interaction with ZO-1. Sufficient for the tight junction localization. Involved in the regulation of the permeability barrier function of the tight junction (By similarity). The first extracellular loop participates in an adhesive interaction.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR. Dephosphorylated by PTPRJ. The tyrosine phosphorylation on Tyr-398 and Tyr-402 reduces its ability to interact with TJP1.
  • Cellular localization
    Membrane. Cell junction > tight junction.
  • Information by UniProt
  • Database links
  • Alternative names
    • BLCPMG antibody
    • FLJ08163 antibody
    • FLJ18079 antibody
    • FLJ77961 antibody
    • FLJ94056 antibody
    • MGC34277 antibody
    • Occludin antibody
    • Ocln antibody
    • OCLN_HUMAN antibody
    • Phosphatase 1 regulatory subunit 115 antibody
    • PPP1R115 antibody
    • PTORCH1 antibody
    • Tight junction protein occludin antibody
    see all

Images

  • Anti-Occludin antibody (ab168986) at 1 µg/ml + Human liver lysate at 50 µg

    Secondary
    Goat Anti-Rabbit IgG (H+L)-HRP at 1/7500 dilution

    Developed using the ECL technique.

    Predicted band size: 59 kDa

  • IHC image of Occludin staining in Human normal kidney formalin fixed paraffin embedded tissue section*, performed on a Leica Bond™ system using the standard protocol F. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH6, epitope retrieval solution 1) for 20 mins. The section was then incubated with ab168986, 5µg/ml, for 15 mins at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with haematoxylin and mounted with DPX.

    For other IHC staining systems (automated and non-automated) customers should optimize variable parameters such as antigen retrieval conditions, primary antibody concentration and antibody incubation times.

    *Tissue obtained from the Human Research Tissue Bank, supported by the NIHR Cambridge Biomedical Research Centre

  • Anti-Occludin antibody (ab168986) at 1 µg/ml + Mouse liver lysate at 50 µg

    Secondary
    Goat Anti-Rabbit IgG (H+L)-HRP at 1/7500 dilution

    Developed using the ECL technique.

    Predicted band size: 59 kDa

  • All lanes : Anti-Occludin antibody (ab168986) at 1 µg/ml

    Lane 1 : Occludin-transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG at 1/7500 dilution

    Developed using the ECL technique.

    Predicted band size: 59 kDa

References

This product has been referenced in:
  • Ma X  et al. Activation of GABAA Receptors in Colon Epithelium Exacerbates Acute Colitis. Front Immunol 9:987 (2018). Read more (PubMed: 29867964) »
  • Wu J  et al. Maternal and early-life vitamin D deficiency enhances allergic reaction in an ovalbumin-sensitized BALB/c mouse model. Food Nutr Res 62:N/A (2018). Read more (PubMed: 29881333) »
See all 8 Publications for this product

Customer reviews and Q&As

1-4 of 4 Abreviews or Q&A

Application
Western blot
Sample
Rat Cell lysate - whole cell (Enteric glial cell)
Gel Running Conditions
Non-reduced Denaturing (4-12% Bis Acrylamide)
Loading amount
50 µg
Specification
Enteric glial cell
Blocking step
Milk as blocking agent for 3 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Nov 08 2017

Application
Immunohistochemistry (Frozen sections)
Sample
Rat Tissue sections (brain)
Permeabilization
Yes - Triton-X 100
Specification
brain
Blocking step
donkey serum as blocking agent for 10 minute(s) · Concentration: 2% · Temperature: 21°C
Fixative
Paraformaldehyde

Alyssa Cortella

Verified customer

Submitted Mar 14 2017

Application
Western blot
Sample
Rhesus monkey Tissue lysate - whole (Colon)
Gel Running Conditions
Reduced Denaturing
Loading amount
2500 µg
Specification
Colon
Blocking step
BSA as blocking agent for 45 minute(s) · Concentration: 2% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Nov 09 2016

Abcam has not validated the combination of species/application used in this Abreview.
Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (CaCo-2)
Permeabilization
Yes - 0.5% Triton X-100
Specification
CaCo-2
Blocking step
BSA as blocking agent for 30 hour(s) and 0 minute(s) · Concentration: 2% · Temperature: 22°C
Fixative
Paraformaldehyde

Mrs. Annelies Bunschoten

Verified customer

Submitted Nov 01 2016

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up